Gene Gene information from NCBI Gene database.
Entrez ID 9647
Gene name Protein phosphatase, Mg2+/Mn2+ dependent 1F
Gene symbol PPM1F
Synonyms (NCBI Gene)
CAMKPCaMKPaseFEM-2POPX2hFEM-2
Chromosome 22
Chromosome location 22q11.22
Summary The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange f
miRNA miRNA information provided by mirtarbase database.
519
miRTarBase ID miRNA Experiments Reference
MIRT006619 rno-miR-200c-3p ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot 22144583
MIRT006619 rno-miR-200c-3p ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot 22144583
MIRT030441 hsa-miR-24-3p Microarray 19748357
MIRT045175 hsa-miR-186-5p CLASH 23622248
MIRT043063 hsa-miR-324-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IBA
GO:0004722 Function Protein serine/threonine phosphatase activity IDA 11559703, 11864573, 15140879, 20801214
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IMP 20016286
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619309 19388 ENSG00000100034
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P49593
Protein name Protein phosphatase 1F (EC 3.1.3.16) (Ca(2+)/calmodulin-dependent protein kinase phosphatase) (CaM-kinase phosphatase) (CaMKPase) (Partner of PIX 2) (Protein fem-2 homolog) (hFem-2)
Protein function Dephosphorylates and concomitantly deactivates CaM-kinase II activated upon autophosphorylation, and CaM-kinases IV and I activated upon phosphorylation by CaM-kinase kinase. Promotes apoptosis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00481 PP2C 155 406 Protein phosphatase 2C Family
Sequence
MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAE
LAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEEKAPVTLL
DAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFN
QLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQ
MFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEK
ARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACD
GFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNI
TVMVVFLRDPQELL
EGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS
Sequence length 454
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Clear cell carcinoma of kidney Uncertain significance rs189969314 RCV005926466
Thyroid cancer, nonmedullary, 1 Uncertain significance rs189969314 RCV005926467
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 22144583
Carcinoma Hepatocellular Associate 30470261
Cholangitis Sclerosing Associate 30250217
Depressive Disorder Associate 31446381
Glioblastoma Associate 35443151
Growth Disorders Associate 30250217
Hypothyroidism Associate 30250217
Liver Diseases Associate 30250217
Neoplasm Metastasis Associate 30470261, 35443151
Neoplasms Associate 22144583, 30470261, 35443151