Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9641
Gene name Gene Name - the full gene name approved by the HGNC.	Inhibitor of nuclear factor kappa B kinase subunit epsilon
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IKBKE
Synonyms (NCBI Gene) Gene synonyms aliases	IKK-E, IKK-i, IKKE, IKKI
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast

Show/Hide all(189)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003484	hsa-miR-155-5p	qRT-PCR, Western blot	18753206
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay	19177201
MIRT003484	hsa-miR-155-5p	Review	20026422
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT006572	hsa-miR-296-5p	Luciferase reporter assay	22114321
MIRT003484	hsa-miR-155-5p	Proteomics	20584899
MIRT022344	hsa-miR-124-3p	Microarray	18668037
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay, Western blot	24151514
MIRT003484	hsa-miR-155-5p	Luciferase reporter assay, Western blot	24151514
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT003484	hsa-miR-155-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26934326
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063076	hsa-miR-4717-5p	CLIP-seq
MIRT1063077	hsa-miR-4729	CLIP-seq
MIRT1063078	hsa-miR-4753-5p	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT1063065	hsa-miR-155	CLIP-seq
MIRT1063066	hsa-miR-2682	CLIP-seq
MIRT1063067	hsa-miR-3190	CLIP-seq
MIRT1063068	hsa-miR-3202	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT1063071	hsa-miR-3714	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063074	hsa-miR-449c	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT1063079	hsa-miR-548ag	CLIP-seq
MIRT1063080	hsa-miR-548ai	CLIP-seq
MIRT1063081	hsa-miR-548an	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550645	hsa-miR-1321	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2550655	hsa-miR-2467-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2550657	hsa-miR-3133	CLIP-seq
MIRT2550658	hsa-miR-3162-5p	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550662	hsa-miR-3188	CLIP-seq
MIRT2550663	hsa-miR-337-3p	CLIP-seq
MIRT1063069	hsa-miR-34a	CLIP-seq
MIRT1063070	hsa-miR-34c-5p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550666	hsa-miR-3975	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550672	hsa-miR-4423-5p	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063072	hsa-miR-449a	CLIP-seq
MIRT1063073	hsa-miR-449b	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550678	hsa-miR-4649-3p	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550688	hsa-miR-4739	CLIP-seq
MIRT2550689	hsa-miR-4756-5p	CLIP-seq
MIRT2550690	hsa-miR-4773	CLIP-seq
MIRT2550691	hsa-miR-4781-3p	CLIP-seq
MIRT2550692	hsa-miR-485-5p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550697	hsa-miR-544b	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq
MIRT2682708	hsa-miR-1207-3p	CLIP-seq
MIRT2550643	hsa-miR-1252	CLIP-seq
MIRT2682709	hsa-miR-128	CLIP-seq
MIRT2550644	hsa-miR-1282	CLIP-seq
MIRT2550646	hsa-miR-146b-3p	CLIP-seq
MIRT2550647	hsa-miR-185	CLIP-seq
MIRT2682710	hsa-miR-1910	CLIP-seq
MIRT2550648	hsa-miR-1915	CLIP-seq
MIRT2550649	hsa-miR-192	CLIP-seq
MIRT2550650	hsa-miR-193a-3p	CLIP-seq
MIRT2550651	hsa-miR-193b	CLIP-seq
MIRT2451670	hsa-miR-1976	CLIP-seq
MIRT2550652	hsa-miR-2110	CLIP-seq
MIRT2550653	hsa-miR-215	CLIP-seq
MIRT2550654	hsa-miR-24	CLIP-seq
MIRT2682711	hsa-miR-27a	CLIP-seq
MIRT2682712	hsa-miR-27b	CLIP-seq
MIRT2682713	hsa-miR-3064-5p	CLIP-seq
MIRT2550656	hsa-miR-3125	CLIP-seq
MIRT2682714	hsa-miR-3135b	CLIP-seq
MIRT2550659	hsa-miR-3173-5p	CLIP-seq
MIRT2550660	hsa-miR-3176	CLIP-seq
MIRT2451671	hsa-miR-3183	CLIP-seq
MIRT2550661	hsa-miR-3187-3p	CLIP-seq
MIRT2550664	hsa-miR-3916	CLIP-seq
MIRT2550665	hsa-miR-3922-3p	CLIP-seq
MIRT2550667	hsa-miR-421	CLIP-seq
MIRT2550668	hsa-miR-4264	CLIP-seq
MIRT2550669	hsa-miR-4271	CLIP-seq
MIRT2550670	hsa-miR-4292	CLIP-seq
MIRT2550671	hsa-miR-4306	CLIP-seq
MIRT2550673	hsa-miR-4435	CLIP-seq
MIRT2550674	hsa-miR-4457	CLIP-seq
MIRT2247226	hsa-miR-4459	CLIP-seq
MIRT2550675	hsa-miR-4476	CLIP-seq
MIRT1063075	hsa-miR-4533	CLIP-seq
MIRT2550676	hsa-miR-4635	CLIP-seq
MIRT2550677	hsa-miR-4644	CLIP-seq
MIRT2550679	hsa-miR-4667-5p	CLIP-seq
MIRT2550680	hsa-miR-4679	CLIP-seq
MIRT2451672	hsa-miR-4695-5p	CLIP-seq
MIRT2550681	hsa-miR-4700-5p	CLIP-seq
MIRT2550682	hsa-miR-4701-5p	CLIP-seq
MIRT2550683	hsa-miR-4704-3p	CLIP-seq
MIRT2550684	hsa-miR-4709-3p	CLIP-seq
MIRT2451673	hsa-miR-4723-3p	CLIP-seq
MIRT2550685	hsa-miR-4725-3p	CLIP-seq
MIRT2550686	hsa-miR-4725-5p	CLIP-seq
MIRT2550687	hsa-miR-4726-3p	CLIP-seq
MIRT2550693	hsa-miR-504	CLIP-seq
MIRT2550694	hsa-miR-513b	CLIP-seq
MIRT2550695	hsa-miR-513c	CLIP-seq
MIRT2550696	hsa-miR-514b-5p	CLIP-seq
MIRT2550698	hsa-miR-548s	CLIP-seq
MIRT2550699	hsa-miR-588	CLIP-seq
MIRT2550700	hsa-miR-604	CLIP-seq
MIRT2550701	hsa-miR-647	CLIP-seq
MIRT2550702	hsa-miR-660	CLIP-seq
MIRT2451674	hsa-miR-665	CLIP-seq
MIRT2550703	hsa-miR-7	CLIP-seq
MIRT2550704	hsa-miR-874	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
STAT3	Activation	22330135
ZNF382	Repression	20682794

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004672	Function	Protein kinase activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004704	Function	NF-kappaB-inducing kinase activity	IDA	10882136
GO:0005515	Function	Protein binding	IPI	14743216, 16177806, 16281057, 17568778, 17599067, 17600090, 18636086, 18636090, 19153231, 20188669, 20657822, 21212807, 21903422, 21931555, 22939624, 23096996, 24706939, 25036637, 25852190, 27980081, 28011935, 29251827, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	20188669
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	20188669, 24882218
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	IDA	10882136, 20188669, 24882218
GO:0006955	Process	Immune response	NAS	10421793
GO:0007252	Process	I-kappaB phosphorylation	IEA
GO:0008384	Function	IkappaB kinase activity	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IMP	20188669
GO:0010008	Component	Endosome membrane	TAS
GO:0010884	Process	Positive regulation of lipid storage	ISS
GO:0016032	Process	Viral process	IEA
GO:0016605	Component	PML body	IDA	20188669
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0019903	Function	Protein phosphatase binding	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24882218
GO:0031966	Component	Mitochondrial membrane	IMP	16876765
GO:0032480	Process	Negative regulation of type I interferon production	TAS
GO:0034340	Process	Response to type I interferon	IEA
GO:0035456	Process	Response to interferon-beta	IMP	24882218
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0036435	Function	K48-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0038061	Process	NIK/NF-kappaB signaling	IEA
GO:0042802	Function	Identical protein binding	IPI	24882218
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	12761501
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:0070530	Function	K63-linked polyubiquitin modification-dependent protein binding	IMP	24882218
GO:0098586	Process	Cellular response to virus	IEA

MIM	HGNC	e!Ensembl
605048	14552	ENSG00000263528

Protein

UniProt ID

Q14164

Protein name

Inhibitor of nuclear factor kappa-B kinase subunit epsilon (I-kappa-B kinase epsilon) (IKK-E) (IKK-epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa-B kinase) (IKK-i)

Protein function

Serine/threonine kinase that plays an essential role in regulating inflammatory responses to viral infection, through the activation of the type I IFN, NF-kappa-B and STAT signaling. Also involved in TNFA and inflammatory cytokines, like Interle

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	9 → 301	Protein kinase domain	Domain
PF18396	TBK1_ULD	308 → 393	TANK binding kinase 1 ubiquitin-like domain	Domain
PF18394	TBK1_CCD1	400 → 646	TANK-binding kinase 1 coiled-coil domain 1	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.

Sequence

MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV

Sequence length

716

Interactions

View interactions

	KEGG		Reactome
	Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway C-type lectin receptor signaling pathway IL-17 signaling pathway Alcoholic liver disease Hepatitis C Hepatitis B Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Chemical carcinogenesis - receptor activation Lipid and atherosclerosis		SUMOylation of immune response proteins TICAM1-dependent activation of IRF3/IRF7 TRAF3-dependent IRF activation pathway TRAF6 mediated IRF7 activation Negative regulators of DDX58/IFIH1 signaling Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	28537254

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Unipolar Depression, Major Depressive Disorder	19786281	ClinVar
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	35029906
Anxiety Disorders	Associate	25798331
Aortic Aneurysm	Associate	28198528
Arthritis	Associate	39524436
Autoimmune Diseases	Associate	23944604
Breast Neoplasms	Associate	17574017, 17574021, 19497997, 19940156, 21182093, 23816933, 25833000, 26177467, 28532474, 29801480, 30289335, 32784074, 35121200, 39684488, 40468448
Breast Neoplasms	Stimulate	20863366, 32783398
Carcinogenesis	Associate	22330135, 32784074
Carcinoma Hepatocellular	Associate	25833000
Carcinoma Intraductal Noninfiltrating	Associate	40468448
Carcinoma Non Small Cell Lung	Associate	22330135, 26025939, 27287717
Carcinoma Pancreatic Ductal	Associate	21685032
Carcinoma Renal Cell	Associate	22266464
Carcinoma Small Cell	Associate	26025939
Carcinoma Squamous Cell	Stimulate	26025939
Colorectal Neoplasms	Associate	28523736, 31869529
Coronavirus Infections	Associate	32747502
COVID 19	Inhibit	24622840
Death	Associate	22266464
Depressive Disorder Major	Associate	25798331
Diabetes Mellitus Type 2	Associate	28683283
Fatty Liver	Associate	28683283
Fever	Associate	39524436
Glioblastoma	Stimulate	28677425
Glioma	Associate	29333957, 39352539
Hereditary Autoinflammatory Diseases	Associate	39524436
Hereditary Breast and Ovarian Cancer Syndrome	Associate	21685032
Hodgkin Disease	Associate	19177201
Infections	Stimulate	15367631
Inflammation	Associate	24151514, 25063733, 25798331, 28683283, 32783398, 39524436
Inflammatory Breast Neoplasms	Associate	40468448
Insulin Resistance	Associate	28683283
Lupus Erythematosus Systemic	Associate	32146614, 39524436
Lymphatic Metastasis	Associate	28532474
Mental Disorders	Associate	25798331
Metabolic Diseases	Associate	28683283
Multiple Trauma	Associate	23944604
Neoplasm Metastasis	Associate	25474241, 27574806, 28532474
Neoplasms	Stimulate	17574021, 27145266
Neoplasms	Associate	19497997, 22266464, 26025939, 27574806, 28532474, 30289335, 32783398, 32784074
Obesity	Stimulate	28683283
Oral Ulcer	Associate	39524436
Ovarian Neoplasms	Associate	19497997, 25474241
Panic Disorder	Associate	25798331
Prostatic Neoplasms	Associate	17259348
Pulmonary Disease Chronic Obstructive	Associate	26498252
Sarcoma Kaposi	Associate	30029010
Shock Septic	Associate	10477696
Sjogren's Syndrome	Associate	26380323
Stomach Neoplasms	Associate	27145266, 30487159
Stomatitis Aphthous	Associate	40468448
Triple Negative Breast Neoplasms	Associate	29801480, 31662325
Undiagnosed Diseases	Associate	39524436
Vasculitis	Associate	32146614
Virus Diseases	Associate	21182093, 34908452, 37328105

IKBKE (inhibitor of nuclear factor kappa B kinase subunit epsilon)