RGS6 (regulator of G protein signaling 6)

Gene

• Entrez ID: 9628
• Gene name: Regulator of G protein signaling 6
• Gene symbol: RGS6
• Synonyms (NCBI Gene): GAP, HA117, S914
• Chromosome: 14
• Chromosome location: 14q24.2
• Summary: This gene encodes a member of the RGS (regulator of G protein signaling) family of proteins, which are defined by the presence of a RGS domain that confers the GTPase-activating activity of these proteins toward certain G alpha subunits. This protein also

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT715447	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT715446	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT715445	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT715444	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT715443	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT715442	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715441	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715440	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT715439	hsa-miR-4290	HITS-CLIP	19536157
MIRT715438	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT715437	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT715436	hsa-miR-4279	HITS-CLIP	19536157
MIRT715435	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT715434	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT715433	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT642676	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT642675	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT642674	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT642673	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT642672	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT642671	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT642670	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642669	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT642668	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT642667	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT642666	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT642665	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT642664	hsa-miR-3182	HITS-CLIP	23824327
MIRT642663	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT642662	hsa-miR-938	HITS-CLIP	23824327
MIRT642661	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT642660	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT642659	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT642658	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT642657	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT642656	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT495514	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495513	hsa-miR-6760-5p	PAR-CLIP	22291592
MIRT495512	hsa-miR-1321	PAR-CLIP	22291592
MIRT495511	hsa-miR-4739	PAR-CLIP	22291592
MIRT495510	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT495509	hsa-miR-135a-3p	PAR-CLIP	22291592
MIRT495508	hsa-miR-765	PAR-CLIP	22291592
MIRT495507	hsa-miR-1289	PAR-CLIP	22291592
MIRT495506	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT495505	hsa-miR-3162-5p	PAR-CLIP	22291592
MIRT495504	hsa-miR-5571-3p	PAR-CLIP	22291592
MIRT443861	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT443860	hsa-miR-6838-3p	PAR-CLIP	22100165
MIRT443859	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443858	hsa-miR-5090	PAR-CLIP	22100165
MIRT443856	hsa-miR-6775-5p	PAR-CLIP	22100165
MIRT443857	hsa-miR-4508	PAR-CLIP	22100165
MIRT443855	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT443854	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT443853	hsa-miR-8089	PAR-CLIP	22100165
MIRT443852	hsa-miR-4480	PAR-CLIP	22100165
MIRT443851	hsa-miR-4731-5p	PAR-CLIP	22100165
MIRT443850	hsa-miR-4505	PAR-CLIP	22100165
MIRT443849	hsa-miR-5787	PAR-CLIP	22100165
MIRT443848	hsa-miR-6731-5p	PAR-CLIP	22100165
MIRT443847	hsa-miR-8085	PAR-CLIP	22100165
MIRT443846	hsa-miR-4492	PAR-CLIP	22100165
MIRT443844	hsa-miR-4498	PAR-CLIP	22100165
MIRT443845	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT443843	hsa-miR-762	PAR-CLIP	22100165
MIRT443842	hsa-miR-3175	PAR-CLIP	22100165
MIRT443841	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT443840	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT443839	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT443838	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT443837	hsa-miR-6727-5p	PAR-CLIP	22100165
MIRT443836	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT443835	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT715447	hsa-miR-3681-3p	HITS-CLIP	19536157
MIRT715446	hsa-miR-216a-3p	HITS-CLIP	19536157
MIRT715445	hsa-miR-128-3p	HITS-CLIP	19536157
MIRT715444	hsa-miR-27b-3p	HITS-CLIP	19536157
MIRT715443	hsa-miR-27a-3p	HITS-CLIP	19536157
MIRT715442	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT715441	hsa-miR-205-5p	HITS-CLIP	19536157
MIRT715440	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT715439	hsa-miR-4290	HITS-CLIP	19536157
MIRT715438	hsa-miR-513a-5p	HITS-CLIP	19536157
MIRT715437	hsa-miR-6794-3p	HITS-CLIP	19536157
MIRT715436	hsa-miR-4279	HITS-CLIP	19536157
MIRT715435	hsa-miR-3157-3p	HITS-CLIP	19536157
MIRT715434	hsa-miR-874-3p	HITS-CLIP	19536157
MIRT715433	hsa-miR-629-3p	HITS-CLIP	19536157
MIRT642676	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT642675	hsa-miR-129-1-3p	HITS-CLIP	23824327
MIRT642674	hsa-miR-129-2-3p	HITS-CLIP	23824327
MIRT642673	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT642672	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT642671	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT642670	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642669	hsa-miR-204-3p	HITS-CLIP	23824327
MIRT642668	hsa-miR-4646-5p	HITS-CLIP	23824327
MIRT642667	hsa-miR-3192-5p	HITS-CLIP	23824327
MIRT642666	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT642665	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT642664	hsa-miR-3182	HITS-CLIP	23824327
MIRT642663	hsa-miR-1233-3p	HITS-CLIP	23824327
MIRT642662	hsa-miR-938	HITS-CLIP	23824327
MIRT642661	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT642660	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT642659	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT642658	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT642657	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT642656	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT495514	hsa-miR-4747-3p	PAR-CLIP	22291592
MIRT495513	hsa-miR-6760-5p	PAR-CLIP	22291592
MIRT495512	hsa-miR-1321	PAR-CLIP	22291592
MIRT495511	hsa-miR-4739	PAR-CLIP	22291592
MIRT495510	hsa-miR-4756-5p	PAR-CLIP	22291592
MIRT495509	hsa-miR-135a-3p	PAR-CLIP	22291592
MIRT495508	hsa-miR-765	PAR-CLIP	22291592
MIRT495507	hsa-miR-1289	PAR-CLIP	22291592
MIRT495506	hsa-miR-7106-5p	PAR-CLIP	22291592
MIRT495505	hsa-miR-3162-5p	PAR-CLIP	22291592
MIRT495504	hsa-miR-5571-3p	PAR-CLIP	22291592
MIRT443861	hsa-miR-6895-5p	PAR-CLIP	22100165
MIRT443860	hsa-miR-6838-3p	PAR-CLIP	22100165
MIRT443859	hsa-miR-3691-3p	PAR-CLIP	22100165
MIRT443858	hsa-miR-5090	PAR-CLIP	22100165
MIRT443856	hsa-miR-6775-5p	PAR-CLIP	22100165
MIRT443857	hsa-miR-4508	PAR-CLIP	22100165
MIRT443855	hsa-miR-4667-5p	PAR-CLIP	22100165
MIRT443854	hsa-miR-4700-5p	PAR-CLIP	22100165
MIRT443853	hsa-miR-8089	PAR-CLIP	22100165
MIRT443852	hsa-miR-4480	PAR-CLIP	22100165
MIRT443851	hsa-miR-4731-5p	PAR-CLIP	22100165
MIRT443850	hsa-miR-4505	PAR-CLIP	22100165
MIRT443849	hsa-miR-5787	PAR-CLIP	22100165
MIRT443848	hsa-miR-6731-5p	PAR-CLIP	22100165
MIRT443847	hsa-miR-8085	PAR-CLIP	22100165
MIRT443846	hsa-miR-4492	PAR-CLIP	22100165
MIRT443844	hsa-miR-4498	PAR-CLIP	22100165
MIRT443845	hsa-miR-5001-5p	PAR-CLIP	22100165
MIRT443843	hsa-miR-762	PAR-CLIP	22100165
MIRT443842	hsa-miR-3175	PAR-CLIP	22100165
MIRT443841	hsa-miR-1343-5p	PAR-CLIP	22100165
MIRT443840	hsa-miR-939-5p	PAR-CLIP	22100165
MIRT443839	hsa-miR-6825-5p	PAR-CLIP	22100165
MIRT443838	hsa-miR-185-3p	PAR-CLIP	22100165
MIRT443837	hsa-miR-6727-5p	PAR-CLIP	22100165
MIRT443836	hsa-miR-3150a-3p	PAR-CLIP	22100165
MIRT443835	hsa-miR-6763-5p	PAR-CLIP	22100165
MIRT1304485	hsa-miR-4701-5p	CLIP-seq
MIRT1304486	hsa-miR-588	CLIP-seq
MIRT1304487	hsa-miR-1972	CLIP-seq
MIRT1304488	hsa-miR-4687-3p	CLIP-seq
MIRT1304489	hsa-miR-647	CLIP-seq
MIRT1304490	hsa-let-7a	CLIP-seq
MIRT1304491	hsa-let-7b	CLIP-seq
MIRT1304492	hsa-let-7c	CLIP-seq
MIRT1304493	hsa-let-7d	CLIP-seq
MIRT1304494	hsa-let-7e	CLIP-seq
MIRT1304495	hsa-let-7f	CLIP-seq
MIRT1304496	hsa-let-7g	CLIP-seq
MIRT1304497	hsa-let-7i	CLIP-seq
MIRT1304498	hsa-miR-1224-3p	CLIP-seq
MIRT1304499	hsa-miR-1260	CLIP-seq
MIRT1304500	hsa-miR-1260b	CLIP-seq
MIRT1304501	hsa-miR-1280	CLIP-seq
MIRT1304502	hsa-miR-1294	CLIP-seq
MIRT1304503	hsa-miR-137	CLIP-seq
MIRT1304504	hsa-miR-1915	CLIP-seq
MIRT1304505	hsa-miR-196a	CLIP-seq
MIRT1304506	hsa-miR-196b	CLIP-seq
MIRT1304507	hsa-miR-202	CLIP-seq
MIRT1304508	hsa-miR-203	CLIP-seq
MIRT1304509	hsa-miR-3194-3p	CLIP-seq
MIRT1304510	hsa-miR-34a	CLIP-seq
MIRT1304511	hsa-miR-34c-5p	CLIP-seq
MIRT1304512	hsa-miR-3650	CLIP-seq
MIRT1304513	hsa-miR-3663-3p	CLIP-seq
MIRT1304514	hsa-miR-3665	CLIP-seq
MIRT1304515	hsa-miR-3934	CLIP-seq
MIRT1304516	hsa-miR-3944-5p	CLIP-seq
MIRT1304517	hsa-miR-4267	CLIP-seq
MIRT1304518	hsa-miR-4283	CLIP-seq
MIRT1304519	hsa-miR-4458	CLIP-seq
MIRT1304520	hsa-miR-4459	CLIP-seq
MIRT1304521	hsa-miR-4468	CLIP-seq
MIRT1304522	hsa-miR-4489	CLIP-seq
MIRT1304523	hsa-miR-449a	CLIP-seq
MIRT1304524	hsa-miR-449b	CLIP-seq
MIRT1304525	hsa-miR-4500	CLIP-seq
MIRT1304526	hsa-miR-4663	CLIP-seq
MIRT1304527	hsa-miR-4693-3p	CLIP-seq
MIRT1304528	hsa-miR-4695-5p	CLIP-seq
MIRT1304485	hsa-miR-4701-5p	CLIP-seq
MIRT1304529	hsa-miR-4710	CLIP-seq
MIRT1304530	hsa-miR-4726-3p	CLIP-seq
MIRT1304531	hsa-miR-4773	CLIP-seq
MIRT1304532	hsa-miR-4779	CLIP-seq
MIRT1304533	hsa-miR-4795-3p	CLIP-seq
MIRT1304534	hsa-miR-496	CLIP-seq
MIRT1304535	hsa-miR-532-3p	CLIP-seq
MIRT1304536	hsa-miR-586	CLIP-seq
MIRT1304486	hsa-miR-588	CLIP-seq
MIRT1304537	hsa-miR-605	CLIP-seq
MIRT1304538	hsa-miR-657	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT1304540	hsa-miR-939	CLIP-seq
MIRT1304541	hsa-miR-98	CLIP-seq
MIRT2090209	hsa-miR-1184	CLIP-seq
MIRT2090210	hsa-miR-1205	CLIP-seq
MIRT2090211	hsa-miR-1254	CLIP-seq
MIRT2090212	hsa-miR-205	CLIP-seq
MIRT2090213	hsa-miR-3116	CLIP-seq
MIRT2090214	hsa-miR-3144-5p	CLIP-seq
MIRT2090215	hsa-miR-3158-5p	CLIP-seq
MIRT2090216	hsa-miR-3191	CLIP-seq
MIRT2090217	hsa-miR-320a	CLIP-seq
MIRT2090218	hsa-miR-320b	CLIP-seq
MIRT2090219	hsa-miR-320c	CLIP-seq
MIRT2090220	hsa-miR-320d	CLIP-seq
MIRT2090221	hsa-miR-3918	CLIP-seq
MIRT2090222	hsa-miR-4428	CLIP-seq
MIRT2090223	hsa-miR-4429	CLIP-seq
MIRT2090224	hsa-miR-4434	CLIP-seq
MIRT2090225	hsa-miR-4516	CLIP-seq
MIRT2090226	hsa-miR-4652-5p	CLIP-seq
MIRT2090227	hsa-miR-4768-3p	CLIP-seq
MIRT2090228	hsa-miR-515-3p	CLIP-seq
MIRT2090229	hsa-miR-519e	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq
MIRT1304538	hsa-miR-657	CLIP-seq
MIRT2090231	hsa-miR-661	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT2314969	hsa-miR-1233	CLIP-seq
MIRT2314970	hsa-miR-129-3p	CLIP-seq
MIRT2314971	hsa-miR-1304	CLIP-seq
MIRT1304504	hsa-miR-1915	CLIP-seq
MIRT2314972	hsa-miR-2467-5p	CLIP-seq
MIRT2314973	hsa-miR-3154	CLIP-seq
MIRT2314974	hsa-miR-3166	CLIP-seq
MIRT2314975	hsa-miR-3179	CLIP-seq
MIRT2314976	hsa-miR-3188	CLIP-seq
MIRT2314977	hsa-miR-3190	CLIP-seq
MIRT2090217	hsa-miR-320a	CLIP-seq
MIRT2090218	hsa-miR-320b	CLIP-seq
MIRT2090219	hsa-miR-320c	CLIP-seq
MIRT2090220	hsa-miR-320d	CLIP-seq
MIRT2314978	hsa-miR-376c	CLIP-seq
MIRT2314979	hsa-miR-3975	CLIP-seq
MIRT2314980	hsa-miR-4311	CLIP-seq
MIRT2090223	hsa-miR-4429	CLIP-seq
MIRT2314981	hsa-miR-4448	CLIP-seq
MIRT2314982	hsa-miR-4660	CLIP-seq
MIRT1304530	hsa-miR-4726-3p	CLIP-seq
MIRT2314983	hsa-miR-4755-3p	CLIP-seq
MIRT2090227	hsa-miR-4768-3p	CLIP-seq
MIRT2314984	hsa-miR-485-5p	CLIP-seq
MIRT2314985	hsa-miR-635	CLIP-seq
MIRT1304539	hsa-miR-665	CLIP-seq
MIRT2314986	hsa-miR-671-5p	CLIP-seq
MIRT1304540	hsa-miR-939	CLIP-seq
MIRT2458152	hsa-miR-1262	CLIP-seq
MIRT2458153	hsa-miR-1293	CLIP-seq
MIRT2458154	hsa-miR-4259	CLIP-seq
MIRT2458155	hsa-miR-4483	CLIP-seq
MIRT2458156	hsa-miR-4640-5p	CLIP-seq
MIRT2458157	hsa-miR-4701-3p	CLIP-seq
MIRT2458158	hsa-miR-4726-5p	CLIP-seq
MIRT2611333	hsa-miR-1292	CLIP-seq
MIRT2611334	hsa-miR-370	CLIP-seq
MIRT2611335	hsa-miR-4471	CLIP-seq
MIRT2611336	hsa-miR-4763-5p	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq
MIRT2611333	hsa-miR-1292	CLIP-seq
MIRT2611334	hsa-miR-370	CLIP-seq
MIRT2611335	hsa-miR-4471	CLIP-seq
MIRT2611336	hsa-miR-4763-5p	CLIP-seq
MIRT2090230	hsa-miR-550a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	10521509
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	10083744
GO:0005515	Function	Protein binding	IPI	22939624, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	10521509
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10083744
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IDA	10521509
GO:0016020	Component	Membrane	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043547	Process	Positive regulation of GTPase activity	IDA	10521509

Other IDs

• MIM: 603894
• HGNC: 10002
• e!Ensembl: ENSG00000182732

Protein

• UniProt ID: P49758
• Protein name: Regulator of G-protein signaling 6 (RGS6) (S914)
• Protein function: Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. The RGS6/GNB5 dimer enhances GNAO1 GTPa
• PDB: 2ES0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00610	DEP	43 → 113	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF18148	RGS_DHEX	116 → 217	Regulator of G-protein signalling DHEX domain	Domain
  PF00631	G-gamma	255 → 319	GGL domain	Domain
  PF00615	RGS	336 → 450	Regulator of G protein signaling domain	Domain

• Sequence:

  MAQGSGDQRAVGVADPEESSPNMIVYCKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVV
  TGTDIVQWLMKNLSIEDPVEAIHLGSLIAAQGYIFPISDHVLTMKDDGTFYRFQAPYFWP
  SNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKI
  DRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEES
  QAQSPVHVLSQPIRKTTKEDIRKQITFLNAQIDRHCLKMSKVAESLIAYTEQYVEYDPLI
  TPAEPSNPWISDDVALWDIEMSKEPSQQRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
  ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY
  TFEDAQEHIYKLMKSDSYARFLRSNAYQDLLLAKKKGKSLAGKRLTGLMQSS

• Sequence length: 472

Pathways

Reactome:

G alpha (i) signalling events
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOPENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE ACUTE RESPIRATORY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPORADIC AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenoma	Associate	34092617	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	20642825	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Inhibit	35902557	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35902557	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	34092617	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Associate	25120773, 26097584	★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	19435509	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Inhibit	28665981	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Inhibit	28665981	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Inhibit	35902557	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	35902557	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	25120791	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	35902557	★☆☆☆☆ Found in Text Mining only
Neoplasms Adipose Tissue	Associate	19461586, 21233807	★☆☆☆☆ Found in Text Mining only
Obesity	Associate	28090039	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Associate	28090039	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	25120791	★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24159609	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Associate	36573383	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Associate	35902557	★☆☆☆☆ Found in Text Mining only