GUCA1C (guanylate cyclase activator 1C)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9626
Gene name Gene Name - the full gene name approved by the HGNC.
Guanylate cyclase activator 1C
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GUCA1C
Synonyms (NCBI Gene) Gene synonyms aliases
GCAP3
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3q13.13
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(17)
miRTarBase ID miRNA Experiments Reference
MIRT1038382 hsa-miR-302a CLIP-seq
MIRT1038383 hsa-miR-302b CLIP-seq
MIRT1038384 hsa-miR-302c CLIP-seq
MIRT1038385 hsa-miR-302d CLIP-seq
MIRT1038386 hsa-miR-302e CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0005509 Function Calcium ion binding IBA
GO:0005509 Function Calcium ion binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0007165 Process Signal transduction TAS 10037746
GO:0007601 Process Visual perception TAS 10037746
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
605128 4680 ENSG00000138472
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways
UniProt ID O95843
Protein name Guanylyl cyclase-activating protein 3 (GCAP 3) (Guanylate cyclase activator 1C)
Protein function Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low and inhibits guanylyl cyclases when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of guanylyl cyclase (GC) is a key event in
PDB 2GGZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00036 EF-hand_1 92 → 120 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Retina.
Sequence 
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways
  KEGG   Reactome
  Phototransduction   Inactivation, recovery and regulation of the phototransduction cascade
<