Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9623
Gene name Gene Name - the full gene name approved by the HGNC.	TCL1 family AKT coactivator B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TCL1B
Synonyms (NCBI Gene) Gene synonyms aliases	SYN-1, TML1
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.13

Show/Hide all(48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021345	hsa-miR-9-5p	Microarray	17612493
MIRT025631	hsa-miR-7-5p	Microarray	17612493
MIRT1416621	hsa-miR-1470	CLIP-seq
MIRT1416622	hsa-miR-3184	CLIP-seq
MIRT1416623	hsa-miR-3944-5p	CLIP-seq
MIRT1416624	hsa-miR-423-5p	CLIP-seq
MIRT1416625	hsa-miR-4286	CLIP-seq
MIRT1416626	hsa-miR-4420	CLIP-seq
MIRT1416627	hsa-miR-4667-3p	CLIP-seq
MIRT1416628	hsa-miR-4699-5p	CLIP-seq
MIRT2124927	hsa-miR-1207-5p	CLIP-seq
MIRT2124928	hsa-miR-1972	CLIP-seq
MIRT2124929	hsa-miR-214	CLIP-seq
MIRT2124930	hsa-miR-3194-5p	CLIP-seq
MIRT2124931	hsa-miR-3619-5p	CLIP-seq
MIRT2124932	hsa-miR-3918	CLIP-seq
MIRT2124933	hsa-miR-3926	CLIP-seq
MIRT2124934	hsa-miR-4291	CLIP-seq
MIRT2124935	hsa-miR-4530	CLIP-seq
MIRT2124936	hsa-miR-4640-5p	CLIP-seq
MIRT2124937	hsa-miR-4726-5p	CLIP-seq
MIRT2124938	hsa-miR-4763-3p	CLIP-seq
MIRT2124939	hsa-miR-761	CLIP-seq
MIRT2124940	hsa-miR-922	CLIP-seq
MIRT2124927	hsa-miR-1207-5p	CLIP-seq
MIRT2347374	hsa-miR-1287	CLIP-seq
MIRT2347375	hsa-miR-1827	CLIP-seq
MIRT2124928	hsa-miR-1972	CLIP-seq
MIRT2124929	hsa-miR-214	CLIP-seq
MIRT2347376	hsa-miR-3135b	CLIP-seq
MIRT2347377	hsa-miR-342-5p	CLIP-seq
MIRT2347378	hsa-miR-3612	CLIP-seq
MIRT2124931	hsa-miR-3619-5p	CLIP-seq
MIRT2124932	hsa-miR-3918	CLIP-seq
MIRT2347379	hsa-miR-4443	CLIP-seq
MIRT2124935	hsa-miR-4530	CLIP-seq
MIRT2124936	hsa-miR-4640-5p	CLIP-seq
MIRT2347380	hsa-miR-4664-5p	CLIP-seq
MIRT2124937	hsa-miR-4726-5p	CLIP-seq
MIRT2347381	hsa-miR-4738-3p	CLIP-seq
MIRT2124938	hsa-miR-4763-3p	CLIP-seq
MIRT2347382	hsa-miR-4793-3p	CLIP-seq
MIRT2347383	hsa-miR-4793-5p	CLIP-seq
MIRT2347384	hsa-miR-637	CLIP-seq
MIRT2347385	hsa-miR-650	CLIP-seq
MIRT2124939	hsa-miR-761	CLIP-seq
MIRT2347386	hsa-miR-892b	CLIP-seq
MIRT2347387	hsa-miR-940	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0019901	Function	Protein kinase binding	IPI	10983986
GO:0032991	Component	Protein-containing complex	IDA	10983986
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IBA	21873635
GO:0033138	Process	Positive regulation of peptidyl-serine phosphorylation	IDA	10983986
GO:0043539	Function	Protein serine/threonine kinase activator activity	IBA	21873635
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	10983986
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	10983986

MIM	HGNC	e!Ensembl
603769	11649	ENSG00000213231

Protein

UniProt ID

O95988

Protein name

T-cell leukemia/lymphoma protein 1B (Oncogene TCL-1B) (Oncogene TCL1B) (SYN-1) (Syncytiotrophoblast-specific protein) (TCL1/MTCP1-like protein 1)

Protein function

Enhances the phosphorylation and activation of AKT1 and AKT2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01840	TCL1_MTCP1	1 → 124	TCL1/MTCP1 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in a variety of tissues including placenta and testis. {ECO:0000269|PubMed:10077617, ECO:0000269|PubMed:10344735}.

Sequence

MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT
VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL
TYQPERKD

Sequence length

128

Interactions

View interactions

	KEGG
	PI3K-Akt signaling pathway

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	20228224
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	20228224
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	20228224
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	25475535

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Ataxia Telangiectasia	Associate	11752899
Breast Neoplasms	Associate	20228224
Chromosome Deletion	Associate	32917334
Genetic Diseases Inborn	Associate	32917334
Leukemia Lymphocytic Chronic B Cell	Associate	11752899
Leukemia Lymphoma Adult T Cell	Associate	11839817
Leukemia Prolymphocytic T Cell	Associate	11839817
Leukemia T Cell	Stimulate	10077617
Leukemia T Cell	Associate	11752899
Lymphoma T Cell	Associate	10077617
Neoplasm Metastasis	Stimulate	20228224

TCL1B (TCL1 family AKT coactivator B)