Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9611
Gene name	Nuclear receptor corepressor 1
Gene symbol	NCOR1
Synonyms (NCBI Gene)	N-CoRN-CoR1PPP1R109TRAC1hN-CoR
Chromosome	17
Chromosome location	17p12-p11.2
Summary	This gene encodes a protein that mediates ligand-independent transcription repression of thyroid-hormone and retinoic-acid receptors by promoting chromatin condensation and preventing access of the transcription machinery. It is part of a complex which al

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs751569508	G>A	Likely-pathogenic	Coding sequence variant, missense variant

282

Show/Hide all (282)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052038	hsa-let-7b-5p	CLASH	23622248
MIRT044744	hsa-miR-320a	CLASH	23622248
MIRT041973	hsa-miR-484	CLASH	23622248
MIRT040375	hsa-miR-615-3p	CLASH	23622248
MIRT036031	hsa-miR-1301-3p	CLASH	23622248
MIRT1177419	hsa-miR-1253	CLIP-seq
MIRT1177420	hsa-miR-129-5p	CLIP-seq
MIRT1177421	hsa-miR-2053	CLIP-seq
MIRT1177422	hsa-miR-214	CLIP-seq
MIRT1177423	hsa-miR-2682	CLIP-seq
MIRT1177424	hsa-miR-3123	CLIP-seq
MIRT1177425	hsa-miR-3619-5p	CLIP-seq
MIRT1177426	hsa-miR-3714	CLIP-seq
MIRT1177427	hsa-miR-3925-5p	CLIP-seq
MIRT1177428	hsa-miR-4291	CLIP-seq
MIRT1177429	hsa-miR-4328	CLIP-seq
MIRT1177430	hsa-miR-4433	CLIP-seq
MIRT1177431	hsa-miR-449c	CLIP-seq
MIRT1177432	hsa-miR-548an	CLIP-seq
MIRT1177433	hsa-miR-761	CLIP-seq
MIRT1177434	hsa-miR-922	CLIP-seq
MIRT1177435	hsa-let-7a	CLIP-seq
MIRT1177436	hsa-let-7b	CLIP-seq
MIRT1177437	hsa-let-7c	CLIP-seq
MIRT1177438	hsa-let-7d	CLIP-seq
MIRT1177439	hsa-let-7e	CLIP-seq
MIRT1177440	hsa-let-7f	CLIP-seq
MIRT1177441	hsa-let-7g	CLIP-seq
MIRT1177442	hsa-let-7i	CLIP-seq
MIRT1177443	hsa-miR-106a	CLIP-seq
MIRT1177444	hsa-miR-106b	CLIP-seq
MIRT1177445	hsa-miR-1262	CLIP-seq
MIRT1177446	hsa-miR-1266	CLIP-seq
MIRT1177447	hsa-miR-1293	CLIP-seq
MIRT1177448	hsa-miR-1294	CLIP-seq
MIRT1177420	hsa-miR-129-5p	CLIP-seq
MIRT1177449	hsa-miR-1303	CLIP-seq
MIRT1177450	hsa-miR-132	CLIP-seq
MIRT1177451	hsa-miR-148a	CLIP-seq
MIRT1177452	hsa-miR-148b	CLIP-seq
MIRT1177453	hsa-miR-152	CLIP-seq
MIRT1177454	hsa-miR-1587	CLIP-seq
MIRT1177455	hsa-miR-17	CLIP-seq
MIRT1177456	hsa-miR-182	CLIP-seq
MIRT1177457	hsa-miR-194	CLIP-seq
MIRT1177458	hsa-miR-199a-5p	CLIP-seq
MIRT1177459	hsa-miR-199b-5p	CLIP-seq
MIRT1177460	hsa-miR-202	CLIP-seq
MIRT1177461	hsa-miR-20a	CLIP-seq
MIRT1177462	hsa-miR-20b	CLIP-seq
MIRT1177463	hsa-miR-210	CLIP-seq
MIRT1177464	hsa-miR-2110	CLIP-seq
MIRT1177465	hsa-miR-212	CLIP-seq
MIRT1177466	hsa-miR-216a	CLIP-seq
MIRT1177467	hsa-miR-216b	CLIP-seq
MIRT1177468	hsa-miR-219-2-3p	CLIP-seq
MIRT1177469	hsa-miR-2277-3p	CLIP-seq
MIRT1177470	hsa-miR-2467-3p	CLIP-seq
MIRT1177423	hsa-miR-2682	CLIP-seq
MIRT1177471	hsa-miR-296-3p	CLIP-seq
MIRT1177472	hsa-miR-2964a-3p	CLIP-seq
MIRT1177473	hsa-miR-302a	CLIP-seq
MIRT1177474	hsa-miR-302b	CLIP-seq
MIRT1177475	hsa-miR-302c	CLIP-seq
MIRT1177476	hsa-miR-302d	CLIP-seq
MIRT1177477	hsa-miR-302e	CLIP-seq
MIRT1177478	hsa-miR-3074-3p	CLIP-seq
MIRT1177479	hsa-miR-3120-3p	CLIP-seq
MIRT1177480	hsa-miR-3125	CLIP-seq
MIRT1177481	hsa-miR-3144-5p	CLIP-seq
MIRT1177482	hsa-miR-3147	CLIP-seq
MIRT1177483	hsa-miR-3150a-3p	CLIP-seq
MIRT1177484	hsa-miR-3154	CLIP-seq
MIRT1177485	hsa-miR-3190	CLIP-seq
MIRT1177486	hsa-miR-3191	CLIP-seq
MIRT1177487	hsa-miR-320b	CLIP-seq
MIRT1177488	hsa-miR-320c	CLIP-seq
MIRT1177489	hsa-miR-320d	CLIP-seq
MIRT1177490	hsa-miR-338-5p	CLIP-seq
MIRT1177491	hsa-miR-3607-3p	CLIP-seq
MIRT1177492	hsa-miR-3609	CLIP-seq
MIRT1177493	hsa-miR-361-5p	CLIP-seq
MIRT1177494	hsa-miR-3649	CLIP-seq
MIRT1177495	hsa-miR-365	CLIP-seq
MIRT1177496	hsa-miR-3681	CLIP-seq
MIRT1177497	hsa-miR-3686	CLIP-seq
MIRT1177426	hsa-miR-3714	CLIP-seq
MIRT1177498	hsa-miR-372	CLIP-seq
MIRT1177499	hsa-miR-373	CLIP-seq
MIRT1177500	hsa-miR-376a	CLIP-seq
MIRT1177501	hsa-miR-376b	CLIP-seq
MIRT1177502	hsa-miR-378g	CLIP-seq
MIRT1177503	hsa-miR-380	CLIP-seq
MIRT1177504	hsa-miR-3916	CLIP-seq
MIRT1177505	hsa-miR-3924	CLIP-seq
MIRT1177506	hsa-miR-3974	CLIP-seq
MIRT1177507	hsa-miR-3978	CLIP-seq
MIRT1177508	hsa-miR-4257	CLIP-seq
MIRT1177509	hsa-miR-4261	CLIP-seq
MIRT1177510	hsa-miR-4266	CLIP-seq
MIRT1177511	hsa-miR-4276	CLIP-seq
MIRT1177512	hsa-miR-4302	CLIP-seq
MIRT1177429	hsa-miR-4328	CLIP-seq
MIRT1177513	hsa-miR-4425	CLIP-seq
MIRT1177514	hsa-miR-4429	CLIP-seq
MIRT1177430	hsa-miR-4433	CLIP-seq
MIRT1177515	hsa-miR-4458	CLIP-seq
MIRT1177516	hsa-miR-4483	CLIP-seq
MIRT1177517	hsa-miR-4492	CLIP-seq
MIRT1177518	hsa-miR-4495	CLIP-seq
MIRT1177519	hsa-miR-4496	CLIP-seq
MIRT1177520	hsa-miR-4498	CLIP-seq
MIRT1177431	hsa-miR-449c	CLIP-seq
MIRT1177521	hsa-miR-4500	CLIP-seq
MIRT1177522	hsa-miR-4509	CLIP-seq
MIRT1177523	hsa-miR-4518	CLIP-seq
MIRT1177524	hsa-miR-4652-5p	CLIP-seq
MIRT1177525	hsa-miR-4656	CLIP-seq
MIRT1177526	hsa-miR-4675	CLIP-seq
MIRT1177527	hsa-miR-4680-3p	CLIP-seq
MIRT1177528	hsa-miR-4695-5p	CLIP-seq
MIRT1177529	hsa-miR-4699-3p	CLIP-seq
MIRT1177530	hsa-miR-4700-3p	CLIP-seq
MIRT1177531	hsa-miR-4701-3p	CLIP-seq
MIRT1177532	hsa-miR-4735-5p	CLIP-seq
MIRT1177533	hsa-miR-4741	CLIP-seq
MIRT1177534	hsa-miR-4744	CLIP-seq
MIRT1177535	hsa-miR-4753-3p	CLIP-seq
MIRT1177536	hsa-miR-4775	CLIP-seq
MIRT1177537	hsa-miR-4779	CLIP-seq
MIRT1177538	hsa-miR-4781-3p	CLIP-seq
MIRT1177539	hsa-miR-4789-5p	CLIP-seq
MIRT1177540	hsa-miR-4795-3p	CLIP-seq
MIRT1177541	hsa-miR-4795-5p	CLIP-seq
MIRT1177542	hsa-miR-4796-3p	CLIP-seq
MIRT1177543	hsa-miR-4803	CLIP-seq
MIRT1177544	hsa-miR-499-3p	CLIP-seq
MIRT1177545	hsa-miR-499a-3p	CLIP-seq
MIRT1177546	hsa-miR-519d	CLIP-seq
MIRT1177547	hsa-miR-520a-3p	CLIP-seq
MIRT1177548	hsa-miR-520b	CLIP-seq
MIRT1177549	hsa-miR-520c-3p	CLIP-seq
MIRT1177550	hsa-miR-520d-3p	CLIP-seq
MIRT1177551	hsa-miR-520e	CLIP-seq
MIRT1177552	hsa-miR-542-3p	CLIP-seq
MIRT1177553	hsa-miR-548ah	CLIP-seq
MIRT1177432	hsa-miR-548an	CLIP-seq
MIRT1177554	hsa-miR-548k	CLIP-seq
MIRT1177555	hsa-miR-548n	CLIP-seq
MIRT1177556	hsa-miR-548t	CLIP-seq
MIRT1177557	hsa-miR-561	CLIP-seq
MIRT1177558	hsa-miR-577	CLIP-seq
MIRT1177559	hsa-miR-582-3p	CLIP-seq
MIRT1177560	hsa-miR-584	CLIP-seq
MIRT1177561	hsa-miR-590-3p	CLIP-seq
MIRT1177562	hsa-miR-635	CLIP-seq
MIRT1177563	hsa-miR-648	CLIP-seq
MIRT1177564	hsa-miR-664	CLIP-seq
MIRT1177565	hsa-miR-7	CLIP-seq
MIRT1177566	hsa-miR-762	CLIP-seq
MIRT1177567	hsa-miR-875-3p	CLIP-seq
MIRT1177568	hsa-miR-877	CLIP-seq
MIRT1177569	hsa-miR-93	CLIP-seq
MIRT1177570	hsa-miR-98	CLIP-seq
MIRT1177479	hsa-miR-3120-3p	CLIP-seq
MIRT1177539	hsa-miR-4789-5p	CLIP-seq
MIRT2051346	hsa-miR-203	CLIP-seq
MIRT1177479	hsa-miR-3120-3p	CLIP-seq
MIRT1177487	hsa-miR-320b	CLIP-seq
MIRT1177488	hsa-miR-320c	CLIP-seq
MIRT1177489	hsa-miR-320d	CLIP-seq
MIRT2051347	hsa-miR-3664-5p	CLIP-seq
MIRT2051348	hsa-miR-3672	CLIP-seq
MIRT1177506	hsa-miR-3974	CLIP-seq
MIRT1177507	hsa-miR-3978	CLIP-seq
MIRT1177514	hsa-miR-4429	CLIP-seq
MIRT2051349	hsa-miR-4457	CLIP-seq
MIRT2051350	hsa-miR-4522	CLIP-seq
MIRT2051351	hsa-miR-4677-3p	CLIP-seq
MIRT2051352	hsa-miR-4679	CLIP-seq
MIRT1177527	hsa-miR-4680-3p	CLIP-seq
MIRT1177529	hsa-miR-4699-3p	CLIP-seq
MIRT1177539	hsa-miR-4789-5p	CLIP-seq
MIRT1177541	hsa-miR-4795-5p	CLIP-seq
MIRT1177544	hsa-miR-499-3p	CLIP-seq
MIRT1177545	hsa-miR-499a-3p	CLIP-seq
MIRT2051353	hsa-miR-507	CLIP-seq
MIRT2051354	hsa-miR-513b	CLIP-seq
MIRT2051355	hsa-miR-548ae	CLIP-seq
MIRT2051356	hsa-miR-548aj	CLIP-seq
MIRT2051357	hsa-miR-548am	CLIP-seq
MIRT2051358	hsa-miR-548c-3p	CLIP-seq
MIRT1177554	hsa-miR-548k	CLIP-seq
MIRT2051359	hsa-miR-548x	CLIP-seq
MIRT2051360	hsa-miR-557	CLIP-seq
MIRT1177564	hsa-miR-664	CLIP-seq
MIRT1177567	hsa-miR-875-3p	CLIP-seq
MIRT1177450	hsa-miR-132	CLIP-seq
MIRT1177465	hsa-miR-212	CLIP-seq
MIRT2280468	hsa-miR-1182	CLIP-seq
MIRT2280469	hsa-miR-1273d	CLIP-seq
MIRT2280470	hsa-miR-1298	CLIP-seq
MIRT1177450	hsa-miR-132	CLIP-seq
MIRT1177451	hsa-miR-148a	CLIP-seq
MIRT1177452	hsa-miR-148b	CLIP-seq
MIRT1177453	hsa-miR-152	CLIP-seq
MIRT2280471	hsa-miR-193a-5p	CLIP-seq
MIRT1177457	hsa-miR-194	CLIP-seq
MIRT1177458	hsa-miR-199a-5p	CLIP-seq
MIRT1177459	hsa-miR-199b-5p	CLIP-seq
MIRT1177463	hsa-miR-210	CLIP-seq
MIRT1177465	hsa-miR-212	CLIP-seq
MIRT1177469	hsa-miR-2277-3p	CLIP-seq
MIRT1177478	hsa-miR-3074-3p	CLIP-seq
MIRT1177479	hsa-miR-3120-3p	CLIP-seq
MIRT1177490	hsa-miR-338-5p	CLIP-seq
MIRT1177493	hsa-miR-361-5p	CLIP-seq
MIRT1177495	hsa-miR-365	CLIP-seq
MIRT1177503	hsa-miR-380	CLIP-seq
MIRT1177505	hsa-miR-3924	CLIP-seq
MIRT1177506	hsa-miR-3974	CLIP-seq
MIRT1177510	hsa-miR-4266	CLIP-seq
MIRT2280472	hsa-miR-4272	CLIP-seq
MIRT1177511	hsa-miR-4276	CLIP-seq
MIRT1177512	hsa-miR-4302	CLIP-seq
MIRT1177518	hsa-miR-4495	CLIP-seq
MIRT1177528	hsa-miR-4695-5p	CLIP-seq
MIRT1177529	hsa-miR-4699-3p	CLIP-seq
MIRT1177532	hsa-miR-4735-5p	CLIP-seq
MIRT2280473	hsa-miR-4742-3p	CLIP-seq
MIRT1177537	hsa-miR-4779	CLIP-seq
MIRT1177539	hsa-miR-4789-5p	CLIP-seq
MIRT1177543	hsa-miR-4803	CLIP-seq
MIRT1177552	hsa-miR-542-3p	CLIP-seq
MIRT2280474	hsa-miR-548a-3p	CLIP-seq
MIRT2051358	hsa-miR-548c-3p	CLIP-seq
MIRT2280475	hsa-miR-548e	CLIP-seq
MIRT2280476	hsa-miR-548f	CLIP-seq
MIRT1177554	hsa-miR-548k	CLIP-seq
MIRT1177555	hsa-miR-548n	CLIP-seq
MIRT1177556	hsa-miR-548t	CLIP-seq
MIRT1177558	hsa-miR-577	CLIP-seq
MIRT1177560	hsa-miR-584	CLIP-seq
MIRT2280477	hsa-miR-630	CLIP-seq
MIRT1177563	hsa-miR-648	CLIP-seq
MIRT1177564	hsa-miR-664	CLIP-seq
MIRT2280468	hsa-miR-1182	CLIP-seq
MIRT2578895	hsa-miR-149	CLIP-seq
MIRT1177454	hsa-miR-1587	CLIP-seq
MIRT2578896	hsa-miR-1976	CLIP-seq
MIRT2578897	hsa-miR-3140-5p	CLIP-seq
MIRT2578898	hsa-miR-3152-3p	CLIP-seq
MIRT2578899	hsa-miR-3646	CLIP-seq
MIRT2578900	hsa-miR-4265	CLIP-seq
MIRT2578901	hsa-miR-4296	CLIP-seq
MIRT2578902	hsa-miR-4322	CLIP-seq
MIRT2578903	hsa-miR-4417	CLIP-seq
MIRT2051349	hsa-miR-4457	CLIP-seq
MIRT1177517	hsa-miR-4492	CLIP-seq
MIRT1177520	hsa-miR-4498	CLIP-seq
MIRT2051350	hsa-miR-4522	CLIP-seq
MIRT1177525	hsa-miR-4656	CLIP-seq
MIRT2578904	hsa-miR-4659a-3p	CLIP-seq
MIRT2578905	hsa-miR-4659b-3p	CLIP-seq
MIRT1177526	hsa-miR-4675	CLIP-seq
MIRT1177533	hsa-miR-4741	CLIP-seq
MIRT1177544	hsa-miR-499-3p	CLIP-seq
MIRT1177545	hsa-miR-499a-3p	CLIP-seq
MIRT2578906	hsa-miR-5096	CLIP-seq
MIRT2051354	hsa-miR-513b	CLIP-seq
MIRT2578907	hsa-miR-515-5p	CLIP-seq
MIRT2051358	hsa-miR-548c-3p	CLIP-seq
MIRT2578908	hsa-miR-760	CLIP-seq
MIRT1177566	hsa-miR-762	CLIP-seq
MIRT2280468	hsa-miR-1182	CLIP-seq
MIRT2578898	hsa-miR-3152-3p	CLIP-seq
MIRT2578899	hsa-miR-3646	CLIP-seq
MIRT2051349	hsa-miR-4457	CLIP-seq
MIRT2051350	hsa-miR-4522	CLIP-seq
MIRT2578906	hsa-miR-5096	CLIP-seq
MIRT2051354	hsa-miR-513b	CLIP-seq
MIRT2051358	hsa-miR-548c-3p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	17876798
RELA	Unknown	17876798
VDR	Activation	23098689

Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	18326024
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	12628926, 18052923, 19955185, 20388878
GO:0000785	Component	Chromatin	IBA
GO:0000785	Component	Chromatin	IDA	17505061, 20388878
GO:0000976	Function	Transcription cis-regulatory region binding	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	18052923
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	IMP	12628926, 15695367, 20812024
GO:0003714	Function	Transcription corepressor activity	TAS
GO:0005515	Function	Protein binding	IPI	10049357, 11013263, 11486045, 11931768, 12628926, 14525983, 16606617, 16980585, 17500595, 17519354, 17572682, 18952841, 19032343, 19955185, 20543827, 20581824, 20812024, 21258344, 21775429, 21988832, 23752268, 25303530, 26120082, 32814053, 33961781, 35140242, 35271311
GO:0005634	Component	Nucleus	IC	18052923
GO:0005634	Component	Nucleus	IDA	10049357
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0010565	Process	Regulation of ketone metabolic process	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016922	Function	Nuclear receptor binding	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	9328355
GO:0017053	Component	Transcription repressor complex	IDA	11804585, 12628926
GO:0017053	Component	Transcription repressor complex	IEA
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	11804585
GO:0045475	Process	Locomotor rhythm	ISS
GO:0045820	Process	Negative regulation of glycolytic process	IMP	19955185
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	20812024
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IMP	19955185
GO:0046329	Process	Negative regulation of JNK cascade	IDA	11931768
GO:0046966	Function	Nuclear thyroid hormone receptor binding	IBA
GO:0048511	Process	Rhythmic process	IEA
GO:0051225	Process	Spindle assembly	IMP	18326024
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IEA
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	20812024
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	19955185
GO:0072686	Component	Mitotic spindle	IDA	18326024
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	IMP	20388878

MIM	HGNC	e!Ensembl
600849	7672	ENSG00000141027

O75376

Protein name

Nuclear receptor corepressor 1 (N-CoR) (N-CoR1)

Protein function

Mediates transcriptional repression by certain nuclear receptors (PubMed:20812024). Part of a complex which promotes histone deacetylation and the formation of repressive chromatin structures which may impede the access of basal transcription fa

PDB

2EQR , 3H52 , 3KMZ , 3N00 , 4MDD , 4WVD , 6ONI , 6WMQ , 6WMS , 6XXS , 6XYX , 6XZZ , 6Y17 , 6ZBU , 8AS9 , 8D8I , 8DKN , 8DKV , 8FHE , 8FHG , 8FKC , 8FKD , 8FKE , 8FKF , 8FKG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15784	GPS2_interact	149 → 238	G-protein pathway suppressor 2-interacting domain	Family
PF00249	Myb_DNA-binding	625 → 670	Myb-like DNA-binding domain	Domain

Sequence

MSSSGYPPNQGAFSTEQSRYPPHSVQYTFPNTRHQQEFAVPDYRSSHLEVSQASQLLQQQ
QQQQLRRRPSLLSEFHPGSDRPQERRTSYEPFHPGPSPVDHDSLESKRPRLEQVSDSHFQ
RVSAAVLPLVHPLPEGLRASADAKKDPAFGGKHEAPSSPISGQPCGDDQNASPSKLSKEE
LIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQIIY
DENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHAR
KQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERFQ
RVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFINM
NGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYYL
TKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDEEEKDE
KEDSKENTKEKDKIDGTAEETEEREQATPRGRKTANSQGRRKGRITRSMTNEAAAASAAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKTSRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEVEAVKPSEDSPENATSRGNTEPAVELEPTTETAPSTSPSLAVPSTKPAEDESV
ETQVNDSISAETAEQMDVDQQEHSAEEGSVCDPPPATKADSVDVEVRVPENHASKVEGDN
TKERDLDRASEKVEPRDEDLVVAQQINAQRPEPQSDNDSSATCSADEDVDGEPERQRMFP
MDSKPSLLNPTGSILVSSPLKPNPLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALY
QRHIKAMHESALLEEQRQRQEQIDLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPE
GVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLTSHNQASYTQETPK
PSVGSISLGLPRQQESAKSATLPYIKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAIQ
EGSITRGTPTSKISVESIPSLRGSITQGTPALPQTGIPTEALVKGSISRMPIEDSSPEKG
REEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEISLKRSYESVEGNIKQGMSM
RESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATTESFEDGLKYPKQIKR
ESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTPEVVQSTRPIIEG
SISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLSRGMPPLEIVPENIKVVERGKYEDVKA
GETVRSRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDTSARRTPVSYQNTMSRGSPMMN
RTSDVTISSNKSTNHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHRGSTAGEVY
RSHLPTHLDPAMPFHRALDPAAAAYLFQRQLSPTPGYPSQYQLYAMENTRQTILNDYITS
QQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHPGGTSTPPMDRITY
IPGTQITFPPRPYNSASMSPGHPTHLAAAASAEREREREREKERERERIAAASSDLYLRP
GSEQPGRPGSHGYVRSPSPSVRTQETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPA
GGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESKHEAARLEENLRSRSAAV
SEQQQLEQKTLEVEKRSVQCLYTSSAFPSGKPQPHSSVVYSEAGKDKGPPPKSRYEEELR
TRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSSHRYETPSDAIEVISPAS
SPAPPQEKLQTYQPEVVKANQAENDPTRQYEGPLHHYRPQQESPSPQQQLPPSSQAEGMG
QVPRTHRLITLADHICQIITQDFARNQVSSQTPQQPPTSTFQNSPSALVSTPVRTKTSNR
YSPESQAQSVHHQRPGSRVSPENLVDKSRGSRPGKSPERSHVSSEPYEPISPPQVPVVHE
KQDSLLLLSQRGAEPAEQRNDARSPGSISYLPSFFTKLENTSPMVKSKKQEIFRKLNSSG
GGDSDMAAAQPGTEIFNLPAVTTSGSVSSRGHSFADPASNLGLEDIIRKALMGSFDDKVE
DHGVVMSQPMGVVPGTANTSVVTSGETRREEGDPSPHSGGVCKPKLISKSNSRKSKSPIP
GQGYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYNPLTMRMLSSTPPTP
IACAPSAVNQAAPHQQNRIWEREPAPLLSAQYETLSDSDD

Sequence length

2440

Interactions

View interactions

	KEGG		Reactome
	Endocrine resistance TGF-beta signaling pathway Thyroid hormone signaling pathway Transcriptional misregulation in cancer		Nuclear signaling by ERBB4 PPARA activates gene expression Transcriptional activation of mitochondrial biogenesis Downregulation of SMAD2/3:SMAD4 transcriptional activity Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants HDACs deacetylate histones Notch-HLH transcription pathway Transcriptional regulation of white adipocyte differentiation Nuclear Receptor transcription pathway Regulation of lipid metabolism by PPARalpha Circadian Clock NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux HCMV Early Events NR1H2 & NR1H3 regulate gene expression to control bile acid homeostasis

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Developmental delay	Likely pathogenic	rs751569508	RCV000497182
Hyperlaxity	Likely pathogenic	rs751569508	RCV000497182
Thin skin	Likely pathogenic	rs751569508	RCV000497182

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Benign; Likely benign	rs139149781	RCV005906338
Colon adenocarcinoma	Benign	rs7210057	RCV005903772
Familial cancer of breast	Uncertain significance; Benign	rs869025295, rs12942295	RCV000207335 RCV005937185
Gastric cancer	Likely benign; Benign	rs193239957, rs7210057	RCV005933491 RCV005903774
NCOR1-related autism spectrum disorder	Uncertain significance	rs1215962055	RCV002227772
NCOR1-related disorder	Uncertain significance; Benign; Likely benign	rs12942684, rs571174228, rs117442740, rs140669097, rs2152721736, rs376830568, rs527871403, rs150168981, rs150513105, rs139458532, rs147661610, rs61754982, rs371602300, rs377698372, rs200458310 View all (27 more)	RCV003416687 RCV003408576 RCV003901048 RCV003923949 RCV003894249 RCV003906885 RCV003977058 RCV003911580 RCV003909617 RCV003909737 RCV003961681 RCV003981223 RCV003961360 RCV003914314 RCV003941364 RCV003958927 RCV003954709 RCV003961934 RCV003921947 RCV003979192 RCV003982025 RCV003961984 RCV003967190 RCV003976694 RCV003972194 RCV004755044 RCV003933296 RCV003915945 RCV003935890 RCV003913233 RCV003915946 RCV003916211 RCV003910403 RCV003920617 RCV003920731 RCV003920563 RCV003920618 RCV003950558 RCV003975673 RCV003895470 RCV003960429 RCV003928523
NCOR1-related Neurodevelopmental disorder	Uncertain significance	rs2060557128	RCV004799401
Sarcoma	Benign	rs7210057	RCV005903773
Uterine corpus endometrial carcinoma	Benign	rs7210057	RCV005903775

Show/Hide Text Mining Associations (50)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30485330
Aortic Aneurysm Abdominal	Associate	26498477
Apraxias	Associate	27120335
Arthritis Rheumatoid	Associate	30138371
Astrocytoma	Associate	21143702
Atherosclerosis	Associate	30138371
Autistic Disorder	Associate	27824329
Breast Neoplasms	Associate	19183483, 20003447, 22622808, 27375289, 30305115, 30485330, 30883028, 32441016, 32811538, 33191115, 33962648, 34454393, 36443319, 37925055, 38003265, 39264897 View all (1 more)
Calcinosis Cutis	Associate	32811538
Carcinoma	Associate	31467233
Carcinoma Hepatocellular	Associate	31072138, 32393195
Carcinoma Non Small Cell Lung	Associate	21966475, 31661545
Carcinoma Pancreatic Ductal	Associate	34454393
Carcinoma Squamous Cell	Associate	31661545
Carcinoma Transitional Cell	Associate	21822268
Colorectal Neoplasms	Associate	25823659, 27023146, 30039904
Developmental Disabilities	Associate	29483668
Diabetes Mellitus Type 1	Associate	24204704
Endometrial Hyperplasia	Associate	14601091, 19414341
Esophageal Neoplasms	Associate	22675025
Fever	Associate	36216898
Hematologic Neoplasms	Associate	12590135
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30485330
Hypoglycemia	Associate	32034166
Hypoxia	Associate	28126478
Immune System Diseases	Associate	35687490
Inflammation	Associate	31565033
Intellectual Disability	Associate	29483668
Iron Deficiencies	Associate	32034166
Leukemia	Associate	15729358, 25928846, 28611288
Leukemia Monocytic Acute	Associate	23940660
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26117541
Leukemia Myeloid Acute	Associate	23940660, 25928846, 9819404
Leukemia Promyelocytic Acute	Associate	14701861, 17699721, 21966475, 9531570
Lymphoma	Associate	35687490
Lymphoma Large B Cell Diffuse	Associate	31197180, 35687490
Melanoma	Associate	25823659
Neoplasms	Associate	16309230, 19414341, 22722201, 24096568, 25823659, 28126478, 30039904, 31427592, 33058520, 33763074, 39264897
Neoplasms	Inhibit	21966475, 30485330, 31661545
Noonan Syndrome	Associate	30039904
Prostatic Neoplasms	Associate	20466759, 23087083, 25189356, 33058520
Pulmonary Disease Chronic Obstructive	Stimulate	40655182
Recombinant chromosome 8 syndrome	Associate	35578198
Rett Syndrome	Associate	28348241
Sarcoma	Associate	32520634
Thyroid Hormone Resistance Syndrome	Associate	39299378
Triple Negative Breast Neoplasms	Associate	32441016
Urinary Bladder Neoplasms	Associate	19126649, 27699256, 33763074
Uterine Cervical Dysplasia	Associate	18248679
Uterine Cervical Neoplasms	Associate	33861372

NCOR1 (nuclear receptor corepressor 1)