Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9607
Gene name Gene Name - the full gene name approved by the HGNC.
CART prepropeptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CARTPT
Synonyms (NCBI Gene) Gene synonyms aliases
CART
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expre
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909065 G>C Risk-factor Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT863123 hsa-miR-1324 CLIP-seq
MIRT863124 hsa-miR-3163 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
REST Repression 18485095
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001678 Process Intracellular glucose homeostasis IDA 11711504
GO:0003674 Function Molecular_function ND
GO:0005184 Function Neuropeptide hormone activity IEA
GO:0005515 Function Protein binding IPI 21982860, 32296183
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602606 24323 ENSG00000164326
Protein
UniProt ID Q16568
Protein name Cocaine- and amphetamine-regulated transcript protein [Cleaved into: CART(1-39); CART(42-89)]
Protein function Satiety factor closely associated with the actions of leptin and neuropeptide Y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by lep
PDB 1HY9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06373 CART 47 116 Cocaine and amphetamine regulated transcript protein (CART) Family
Tissue specificity TISSUE SPECIFICITY: Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus.
Sequence
MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEV
LKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Sequence length 116
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Glioblastoma Glioblastoma N/A N/A GWAS
Obesity obesity, inherited obesity N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Mucinous Associate 32781417
Anxiety Associate 35476439
Aortic Aneurysm Thoracic Associate 37823268
Aortic Dissection Associate 37823268
Brain Edema Stimulate 35650594
Brain Neoplasms Associate 37343521
Breast Neoplasms Associate 22139072, 35115550, 37480115
Burkitt Lymphoma Associate 35222407
Calcinosis Cutis Inhibit 32527643
Chemical and Drug Induced Liver Injury Stimulate 23423337