Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9586
Gene name Gene Name - the full gene name approved by the HGNC.
CAMP responsive element binding protein 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CREB5
Synonyms (NCBI Gene) Gene synonyms aliases
CRE-BPA, CREB-5, CREBPA
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p15.1-p14.3
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun o
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006460 hsa-miR-204-5p Immunofluorescence, Microarray, qRT-PCR, Western blot 22523078
MIRT006462 hsa-miR-211-5p Immunofluorescence, Microarray, qRT-PCR, Western blot 22523078
MIRT006460 hsa-miR-204-5p Immunofluorescence, Microarray, qRT-PCR, Western blot 22523078
MIRT006462 hsa-miR-211-5p Immunofluorescence, Microarray, qRT-PCR, Western blot 22523078
MIRT021286 hsa-miR-125a-5p Sequencing 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity IDA 8378084
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
618262 16844 ENSG00000146592
Protein
UniProt ID Q02930
Protein name Cyclic AMP-responsive element-binding protein 5 (CREB-5) (cAMP-responsive element-binding protein 5) (cAMP-response element-binding protein A) (CRE-BPa)
Protein function Binds to the cAMP response element and activates transcription.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00170 bZIP_1 373 436 bZIP transcription factor Coiled-coil
Sequence
MIYEESKMNLEQERPFVCSAPGCSQRFPTEDHLMIHRHKHEMTLKFPSIKTDNMLSDQTP
TPTRFLKNCEEVGLFSELDCSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSA
RLPNHDTNVVIQQAMPSPQSSSVITQAPSTNRQIGPVPGSLSSLLHLHNRQRQPMPASMP
GTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAAL
THHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHH
PHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQ
PTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNE
VSMLKNEVAQLKQLLL
THKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTIT
TSSSVSEVVGSSTLSQLTTHRTDLNPIL
Sequence length 508
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Thermogenesis
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Relaxin signaling pathway
Cortisol synthesis and secretion
Parathyroid hormone synthesis, secretion and action
Insulin resistance
Cushing syndrome
Growth hormone synthesis, secretion and action
Vasopressin-regulated water reabsorption
Huntington disease
Prion disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Viral carcinogenesis
Chemical carcinogenesis - receptor activation
Prostate cancer
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Dermatitis Atopic dermatitis (moderate to severe), Atopic dermatitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 32755048
Amyotrophic Lateral Sclerosis Associate 31118040
Atherosclerosis Associate 36720950, 40708018
Breast Neoplasms Associate 35662106
Carcinogenesis Associate 35662106
Carcinoma Hepatocellular Associate 36565037, 37996058
Colorectal Neoplasms Stimulate 25076032
Colorectal Neoplasms Associate 29945573, 37816820
Coronavirus Infections Associate 34176764
Depressive Disorder Treatment Resistant Stimulate 36603462