APOBEC3B (apolipoprotein B mRNA editing enzyme catalytic subunit 3B)

Gene

• Entrez ID: 9582
• Gene name: Apolipoprotein B mRNA editing enzyme catalytic subunit 3B
• Gene symbol: APOBEC3B
• Synonyms (NCBI Gene): A3B, APOBEC1L, ARCD3, ARP4, DJ742C19.2, PHRBNL, bK150C2.2
• Chromosome: 22
• Chromosome location: 22q13.1
• Summary: This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and fu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016537	hsa-miR-193b-3p	Microarray	20304954
MIRT756221	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Immunoprecipitaion (IP)	34704004

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IBA
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003824	Function	Catalytic activity	IEA
GO:0004126	Function	Cytidine deaminase activity	IBA
GO:0004126	Function	Cytidine deaminase activity	IMP	22457529
GO:0005515	Function	Protein binding	IPI	31217276, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16699599, 21835787
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010526	Process	Transposable element silencing	IDA	16527742
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0016554	Process	Cytidine to uridine editing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0044355	Process	Clearance of foreign intracellular DNA	IDA	20062055
GO:0044355	Process	Clearance of foreign intracellular DNA	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045869	Process	Negative regulation of single stranded viral RNA replication via double stranded DNA intermediate	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IDA	22457529, 22915799
GO:0051607	Process	Defense response to virus	IEA
GO:0070383	Process	DNA cytosine deamination	IBA

Other IDs

• MIM: 607110
• HGNC: 17352
• e!Ensembl: ENSG00000179750

Protein

• UniProt ID: Q9UH17
• Protein name: DNA dC->dU-editing enzyme APOBEC-3B (A3B) (EC 3.5.4.38) (Phorbolin-1-related protein) (Phorbolin-2/3)
• Protein function: DNA deaminase (cytidine deaminase) which acts as an inhibitor of retrovirus replication and retrotransposon mobility via deaminase-dependent and -independent mechanisms. After the penetration of retroviral nucleocapsids into target cells of infe
• PDB: 2NBQ, 5CQD, 5CQH, 5CQI, 5CQK, 5SXG, 5SXH, 5TD5, 5TKM, 6NFK, 6NFL, 6NFM, 7RW6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF18782	NAD2	10 → 189		Family
  PF05240	APOBEC_C	301 → 377		Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high and moderate levels in peripheral blood leukocytes, spleen, testes, heart, thymus, prostate and ovary. Also expressed at low levels in several other tissues. {ECO:0000269|PubMed:11863358, ECO:0000269|PubMed:20308164}.
• Sequence:

  MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY
  FKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISA
  ARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAF
  LHRTLKEILRYLMDPDTFTFNFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCN
  EAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQEN
  THVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVYRQGCPFQPWD
  GLEEHSQALSGRLRAILQNQGN

• Sequence length: 382

Pathways

KEGG:

Viral life cycle - HIV-1
Human immunodeficiency virus 1 infection

Reactome:

mRNA Editing: C to U Conversion
Formation of the Editosome

<