Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9568
Gene name Gene Name - the full gene name approved by the HGNC.
Gamma-aminobutyric acid type B receptor subunit 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GABBR2
Synonyms (NCBI Gene) Gene synonyms aliases
DEE59, EIEE59, GABABR2, GPR51, GPRC3B, HG20, HRIHFB2099, NDPLHS
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q22.33
Summary Summary of gene provided in NCBI Entrez Gene.
The multi-pass membrane protein encoded by this gene belongs to the G-protein coupled receptor 3 family and GABA-B receptor subfamily. The GABA-B receptors inhibit neuronal activity through G protein-coupled second-messenger systems, which regulate the re
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs2184026 C>G,T Risk-factor Genic upstream transcript variant, intron variant
rs2491397 C>T Risk-factor Intron variant
rs3750344 T>C,G Risk-factor Coding sequence variant, genic upstream transcript variant, synonymous variant
rs922847767 C>T Pathogenic Missense variant, coding sequence variant
rs1554689313 C>T Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022745 hsa-miR-124-3p Microarray 18668037
MIRT613027 hsa-miR-129-5p HITS-CLIP 23824327
MIRT613026 hsa-miR-450b-5p HITS-CLIP 23824327
MIRT613025 hsa-miR-507 HITS-CLIP 23824327
MIRT613024 hsa-miR-557 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004965 Function G protein-coupled GABA receptor activity IDA 9872316
GO:0004965 Function G protein-coupled GABA receptor activity IEA
GO:0004965 Function G protein-coupled GABA receptor activity TAS 10328880
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607340 4507 ENSG00000136928
Protein
UniProt ID O75899
Protein name Gamma-aminobutyric acid type B receptor subunit 2 (GABA-B receptor 2) (GABA-B-R2) (GABA-BR2) (GABABR2) (Gb2) (G-protein coupled receptor 51) (HG20)
Protein function Component of a heterodimeric G-protein coupled receptor for GABA, formed by GABBR1 and GABBR2 (PubMed:15617512, PubMed:18165688, PubMed:22660477, PubMed:24305054, PubMed:9872316, PubMed:9872744). Within the heterodimeric GABA receptor, only GABB
PDB 4F11 , 4F12 , 4MQE , 4MQF , 4MR7 , 4MR8 , 4MR9 , 4MRM , 4MS1 , 4MS3 , 4MS4 , 4PAS , 6M8R , 6OCP , 6UO8 , 6UO9 , 6UOA , 6VJM , 6W2X , 6WIV , 7C7Q , 7C7S , 7CA3 , 7CA5 , 7CUM , 7EB2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 76 435 Receptor family ligand binding region Family
PF00003 7tm_3 493 746 7 transmembrane sweet-taste receptor of 3 GCPR Family
PF18455 GBR2_CC 779 817 Gamma-aminobutyric acid type B receptor subunit 2 coiled-coil domain Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain, especially in cerebral cortex, thalamus, hippocampus, frontal, occipital and temporal lobe, occipital pole and cerebellum, followed by corpus callosum, caudate nucleus, spinal cord, amygdala and medulla (PubM
Sequence
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMG
LMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDA
IKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDN
AVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSV
KKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSS
RCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYD
GIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
ERMGTIKFTQFQDSR
EVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLP
LYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLD
GSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVI
VGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIV
YAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQ
FCIVALVIIFCSTITLCLVFVPKLIT
LRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSV
NQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQ
DTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILH
HAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL
Sequence length 941
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  cAMP signaling pathway
Neuroactive ligand-receptor interaction
GABAergic synapse
Taste transduction
Estrogen signaling pathway
GnRH secretion
Morphine addiction
  Activation of G protein gated Potassium channels
G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
GABA B receptor activation
Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 59 rs1554689319, rs1554689315, rs1554689313, rs1554689320 N/A
Epileptic encephalopathy epileptic encephalopathy rs1554689320, rs1178244073, rs922847767 N/A
Neurodevelopmental Disorder With Motor Impairment And Absent Language neurodevelopmental disorder with poor language and loss of hand skills rs1554689313, rs922847767 N/A
Rett Syndrome rett syndrome rs922847767 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Schizophrenia Schizophrenia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenoma Stimulate 19381877
Agnosia Associate 38482990
Alzheimer Disease Associate 33218044, 36776048
Anxiety Associate 35301427
Arrhythmogenic Right Ventricular Dysplasia Associate 30664203
Autism Spectrum Disorder Associate 32807774, 34069769
Autistic Disorder Associate 19002745
Bipolar Disorder Inhibit 21303731, 24022508
Bipolar Disorder Associate 38482990
Brain Diseases Associate 36103875