Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9564
Gene name Gene Name - the full gene name approved by the HGNC.	BCAR1 scaffold protein, Cas family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BCAR1
Synonyms (NCBI Gene) Gene synonyms aliases	CAS, CAS1, CASS1, CRKAS, P130Cas
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded p

Show/Hide all(73)

miRTarBase ID	miRNA	Experiments	Reference
MIRT697058	hsa-miR-548aa	HITS-CLIP	23313552
MIRT697057	hsa-miR-548ap-3p	HITS-CLIP	23313552
MIRT697056	hsa-miR-548t-3p	HITS-CLIP	23313552
MIRT697055	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT697054	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT697053	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT697052	hsa-miR-580-5p	HITS-CLIP	23313552
MIRT697051	hsa-miR-105-5p	HITS-CLIP	23313552
MIRT697050	hsa-miR-7853-5p	HITS-CLIP	23313552
MIRT697049	hsa-miR-509-3p	HITS-CLIP	23313552
MIRT697048	hsa-miR-3148	HITS-CLIP	23313552
MIRT697047	hsa-miR-6124	HITS-CLIP	23313552
MIRT697046	hsa-miR-139-3p	HITS-CLIP	23313552
MIRT697045	hsa-miR-3978	HITS-CLIP	23313552
MIRT697058	hsa-miR-548aa	HITS-CLIP	23313552
MIRT697057	hsa-miR-548ap-3p	HITS-CLIP	23313552
MIRT697056	hsa-miR-548t-3p	HITS-CLIP	23313552
MIRT697055	hsa-miR-4694-3p	HITS-CLIP	23313552
MIRT697054	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT697053	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT697052	hsa-miR-580-5p	HITS-CLIP	23313552
MIRT697051	hsa-miR-105-5p	HITS-CLIP	23313552
MIRT697050	hsa-miR-7853-5p	HITS-CLIP	23313552
MIRT697049	hsa-miR-509-3p	HITS-CLIP	23313552
MIRT697048	hsa-miR-3148	HITS-CLIP	23313552
MIRT697047	hsa-miR-6124	HITS-CLIP	23313552
MIRT697046	hsa-miR-139-3p	HITS-CLIP	23313552
MIRT697045	hsa-miR-3978	HITS-CLIP	23313552
MIRT817503	hsa-miR-3649	CLIP-seq
MIRT817504	hsa-miR-4270	CLIP-seq
MIRT817505	hsa-miR-4300	CLIP-seq
MIRT817506	hsa-miR-4421	CLIP-seq
MIRT817507	hsa-miR-4441	CLIP-seq
MIRT817508	hsa-miR-4487	CLIP-seq
MIRT817509	hsa-miR-4731-5p	CLIP-seq
MIRT817510	hsa-miR-615-5p	CLIP-seq
MIRT817511	hsa-miR-920	CLIP-seq
MIRT1941695	hsa-miR-1197	CLIP-seq
MIRT1941696	hsa-miR-1291	CLIP-seq
MIRT1941697	hsa-miR-146b-3p	CLIP-seq
MIRT1941698	hsa-miR-1470	CLIP-seq
MIRT1941699	hsa-miR-193a-3p	CLIP-seq
MIRT1941700	hsa-miR-193b	CLIP-seq
MIRT1941701	hsa-miR-328	CLIP-seq
MIRT1941702	hsa-miR-329	CLIP-seq
MIRT1941703	hsa-miR-331-3p	CLIP-seq
MIRT1941704	hsa-miR-339-5p	CLIP-seq
MIRT1941705	hsa-miR-342-3p	CLIP-seq
MIRT817503	hsa-miR-3649	CLIP-seq
MIRT1941706	hsa-miR-3688-5p	CLIP-seq
MIRT1941707	hsa-miR-4299	CLIP-seq
MIRT817506	hsa-miR-4421	CLIP-seq
MIRT1941708	hsa-miR-4431	CLIP-seq
MIRT1941709	hsa-miR-4456	CLIP-seq
MIRT1941710	hsa-miR-4469	CLIP-seq
MIRT817508	hsa-miR-4487	CLIP-seq
MIRT1941711	hsa-miR-4651	CLIP-seq
MIRT1941712	hsa-miR-4667-3p	CLIP-seq
MIRT1941713	hsa-miR-4687-5p	CLIP-seq
MIRT817509	hsa-miR-4731-5p	CLIP-seq
MIRT1941714	hsa-miR-4793-3p	CLIP-seq
MIRT1941715	hsa-miR-489	CLIP-seq
MIRT1941716	hsa-miR-508-5p	CLIP-seq
MIRT1941717	hsa-miR-548q	CLIP-seq
MIRT1941718	hsa-miR-564	CLIP-seq
MIRT1941719	hsa-miR-608	CLIP-seq
MIRT817510	hsa-miR-615-5p	CLIP-seq
MIRT1941720	hsa-miR-658	CLIP-seq
MIRT1941721	hsa-miR-766	CLIP-seq
MIRT817510	hsa-miR-615-5p	CLIP-seq
MIRT1941702	hsa-miR-329	CLIP-seq
MIRT1941706	hsa-miR-3688-5p	CLIP-seq
MIRT817506	hsa-miR-4421	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
EGR1	Activation	22431919
NAB2	Activation	22431919

Show/Hide all(42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	TAS	11607844
GO:0001726	Component	Ruffle	IDA	9472046
GO:0005515	Function	Protein binding	IPI	9285683, 9360983, 9407132, 9418872, 9748234, 10339567, 10542110, 10587647, 10889023, 11158326, 11782456, 12799422, 14657239, 14688263, 15866871, 16105984, 16245368, 17038317, 17474147, 18164686, 18722344, 19086031, 19732724, 20534451, 21034468, 22081014, 28007913, 31413325, 31980649
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	8070403
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA	21245381
GO:0005925	Component	Focal adhesion	IBA	21873635
GO:0005925	Component	Focal adhesion	IDA	21245381
GO:0005925	Component	Focal adhesion	ISS
GO:0007015	Process	Actin filament organization	IDA	16105984
GO:0007155	Process	Cell adhesion	IEA
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	10092204
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	8649368
GO:0008286	Process	Insulin receptor signaling pathway	ISS
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	21245381
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016477	Process	Cell migration	IBA	21873635
GO:0016477	Process	Cell migration	IDA	9425168
GO:0017124	Function	SH3 domain binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8070403, 8649368, 9020138, 9472046, 10026197
GO:0030027	Component	Lamellipodium	IEA
GO:0030335	Process	Positive regulation of cell migration	IDA	9472046
GO:0030424	Component	Axon	IEA
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IMP	21245381
GO:0042981	Process	Regulation of apoptotic process	TAS	11607844
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	ISS
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	IMP	21245381
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048011	Process	Neurotrophin TRK receptor signaling pathway	ISS
GO:0048012	Process	Hepatocyte growth factor receptor signaling pathway	IMP	21245381
GO:0050851	Process	Antigen receptor-mediated signaling pathway	IDA	10587647
GO:0050852	Process	T cell receptor signaling pathway	NAS	9295052
GO:0050853	Process	B cell receptor signaling pathway	IDA	9020138
GO:0051301	Process	Cell division	NAS	10675905
GO:0060326	Process	Cell chemotaxis	IMP	21245381
GO:0086100	Process	Endothelin receptor signaling pathway	IDA	19086031
GO:0090527	Process	Actin filament reorganization	IBA	21873635

MIM	HGNC	e!Ensembl
602941	971	ENSG00000050820

Protein

UniProt ID

P56945

Protein name

Breast cancer anti-estrogen resistance protein 1 (CRK-associated substrate) (Cas scaffolding protein family member 1) (p130cas)

Protein function

Docking protein which plays a central coordinating role for tyrosine kinase-based signaling related to cell adhesion (PubMed:12432078, PubMed:12832404). Implicated in induction of cell migration and cell branching (PubMed:12432078, PubMed:128324

PDB

1WYX , 3T6G , 5O2M , 5O2P , 5O2Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	9 → 57	SH3 domain	Domain
PF08824	Serine_rich	454 → 608	Serine rich protein interaction domain	Domain
PF12026	CAS_C	654 → 864	Crk-Associated Substrate C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in B-cells (at protein level) (PubMed:9020138). Widely expressed with an abundant expression in the testis (PubMed:10639512). Low level of expression seen in the liver, thymus, and peripheral blood leukocytes (PubMed:10639512

Sequence

MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA

Sequence length

870

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Chemokine signaling pathway Efferocytosis Focal adhesion Leukocyte transendothelial migration Regulation of actin cytoskeleton Growth hormone synthesis, secretion and action Bacterial invasion of epithelial cells Shigellosis Yersinia infection Human cytomegalovirus infection		Downstream signal transduction p130Cas linkage to MAPK signaling for integrins VEGFA-VEGFR2 Pathway PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Pancreatic cancer	Malignant neoplasm of pancreas	rs118203998, rs180177143, rs587776417, rs587776527, rs864622498, rs876659571, rs587778587, rs886039619, rs745533713, rs1555460431	26098869
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	29295717

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Hypertension	Hypertension	GWAS
Coronary artery disease	Coronary artery disease	GWAS
Myocardial Infarction	Myocardial Infarction	GWAS
Intracranial Aneurysm	Intracranial Aneurysm	GWAS
Diabetes	Diabetes	GWAS

Show/Hide Text Mining Associations (48)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	23904007
Adenocarcinoma of Lung	Associate	33001583, 33334252
Angiofibroma	Associate	14567719
Azoospermia	Associate	27834916
Breast Cancer 3	Associate	17616674
Breast Neoplasms	Associate	10639513, 15642172, 17427198, 17616674, 18256281, 18974122, 19029090, 19330798, 19454314, 20961652, 22431919, 24169358, 24584939, 26716506, 27622508, 33334252, 9056741 View all (2 more)
Calcinosis Cutis	Associate	23345605, 24494199
Carcinogenesis	Associate	22558353
Carcinoma Endometrioid	Associate	29364471
Carcinoma Non Small Cell Lung	Associate	22558353, 23042269, 23904007
Carcinoma Ovarian Epithelial	Associate	26637171
Carcinoma Squamous Cell	Stimulate	23904007
Colorectal Neoplasms	Associate	18392556, 29693170
Coronavirus Infections	Associate	34999179
COVID 19	Associate	34075364, 34999179
Diabetes Mellitus Type 1	Associate	26053495
Diabetes Mellitus Type 2	Associate	25273842, 26053495, 30188962
Disease	Associate	35314527
Endometriosis	Associate	28333195
Glioblastoma	Associate	27293031
Glioma	Associate	21245381
Graves Ophthalmopathy	Associate	30593716
Hemophilia A	Associate	35314527
Hereditary Angioedema Type III	Associate	17427198
Hypertension	Associate	30542083
Leukemia	Stimulate	23287717
Lung Neoplasms	Associate	23042269, 29132432, 30867848, 33001583, 33334252, 36400248
Lymphatic Metastasis	Stimulate	23042269
Lymphatic Metastasis	Associate	23904007, 29364471
Lymphoma	Associate	23287717, 36375119
Lymphoma Large B Cell Diffuse	Associate	36375119
Macular Degeneration	Associate	32246154
Melanoma	Associate	10587647, 16040804
Mouth Neoplasms	Associate	21291860
Nasal Polyps	Associate	14567719
Neoplasm Metastasis	Associate	12738793, 20961652, 29039492, 33144694, 33334252, 37928269
Neoplasms	Associate	10587647, 10639513, 18974122, 21291860, 21765462, 23047035, 23904007, 25482942, 26716506, 27293031, 27622508, 29251173, 29304771, 32184217, 33144694, 33334252, 36400248 View all (2 more)
Neuroblastoma	Associate	17828307
Ovarian Neoplasms	Associate	27622508
Pancreatic Neoplasms	Associate	31917448, 33517887, 34192548
Personality Disorders	Associate	29295717
Prostatic Neoplasms	Associate	29295717, 29304771
Squamous Cell Carcinoma of Head and Neck	Associate	23047035
Stomach Neoplasms	Associate	37928269
Triple Negative Breast Neoplasms	Associate	25482942
Tuberculosis Lymph Node	Associate	26376441
Urinary Bladder Neoplasms	Associate	23345605, 24494199, 33571114
Uterine Cervical Neoplasms	Associate	25100830, 25136604

BCAR1 (BCAR1 scaffold protein, Cas family member)