TP53I3 (tumor protein p53 inducible protein 3)

Gene

• Entrez ID: 9540
• Gene name: Tumor protein p53 inducible protein 3
• Gene symbol: TP53I3
• Synonyms (NCBI Gene): PIG3
• Chromosome: 2
• Chromosome location: 2p23.3
• Summary: The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell dea

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016254	hsa-miR-504-5p	qRT-PCR	20542001
MIRT029187	hsa-miR-26b-5p	Microarray	19088304
MIRT1448270	hsa-miR-1257	CLIP-seq
MIRT1448271	hsa-miR-1299	CLIP-seq
MIRT1448272	hsa-miR-3194-3p	CLIP-seq
MIRT1448273	hsa-miR-3611	CLIP-seq
MIRT1448274	hsa-miR-3925-3p	CLIP-seq
MIRT1448275	hsa-miR-3978	CLIP-seq
MIRT1448276	hsa-miR-4421	CLIP-seq
MIRT1448277	hsa-miR-4464	CLIP-seq
MIRT1448278	hsa-miR-4748	CLIP-seq
MIRT1448279	hsa-miR-4796-5p	CLIP-seq
MIRT1448280	hsa-miR-515-5p	CLIP-seq
MIRT1448281	hsa-miR-578	CLIP-seq
MIRT1448282	hsa-miR-766	CLIP-seq
MIRT1448283	hsa-miR-875-3p	CLIP-seq
MIRT1448284	hsa-miR-942	CLIP-seq
MIRT1448276	hsa-miR-4421	CLIP-seq
MIRT1448279	hsa-miR-4796-5p	CLIP-seq
MIRT1448281	hsa-miR-578	CLIP-seq
MIRT2462179	hsa-miR-516b	CLIP-seq
MIRT2462180	hsa-miR-760	CLIP-seq
MIRT2462181	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TP53	Activation	10101800;14695213
TP53	Unknown	12851404

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003960	Function	Quinone reductase (NADPH) activity	IBA
GO:0003960	Function	Quinone reductase (NADPH) activity	IDA	19349281
GO:0003960	Function	Quinone reductase (NADPH) activity	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006739	Process	NADP+ metabolic process	IDA	19349281
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	19349281
GO:0048038	Function	Quinone binding	IBA
GO:0048038	Function	Quinone binding	IDA	19349281
GO:0070402	Function	NADPH binding	IBA
GO:0070402	Function	NADPH binding	IDA	19349281

Other IDs

• MIM: 605171
• HGNC: 19373
• e!Ensembl: ENSG00000115129

Protein

• UniProt ID: Q53FA7
• Protein name: Quinone oxidoreductase PIG3 (EC 1.6.5.5) (NADPH:quinone reductase PIG3) (Tumor protein p53-inducible protein 3) (Protein PIG3) (p53-induced gene 3 protein)
• Protein function: Catalyzes the NADPH-dependent reduction of quinones (PubMed:19349281). Exhibits a low enzymatic activity with beta-naphthoquinones, with a strong preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-na
• PDB: 2J8Z, 2OBY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08240	ADH_N	27 → 91	Alcohol dehydrogenase GroES-like domain	Domain
  PF00107	ADH_zinc_N	152 → 283	Zinc-binding dehydrogenase	Family

• Sequence:

  MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
  LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
  IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
  AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
  MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
  LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

• Sequence length: 332

Pathways

KEGG:

p53 signaling pathway

Reactome:

TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
TP53I3-related disorder	Uncertain significance; Likely benign; Benign	rs148103343, rs144936276, rs200330465, rs760058149, rs377058047, rs200700296, rs201917137, rs10209238, rs2470198703, rs61741427, rs139475023, rs1435911584, rs34704159, rs145078765, rs140931460, rs35176319, rs138677805, rs61758081, rs33946528, rs752742554, rs34048750	RCV003946475 RCV003392799 RCV003412260 RCV003418843 RCV003894655 RCV003909448 RCV003921724 RCV003982394 RCV003901788 RCV003904777 RCV003977111 RCV003977132 RCV003913938 RCV003962134 RCV003931567 RCV003949693 RCV003956983 RCV003926814 RCV003932125 RCV003969718 RCV003969027

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	34362378
Breast Neoplasms	Associate	25797244, 27111245
Carcinoma Non Small Cell Lung	Associate	28259183
Carcinoma Renal Cell	Associate	27029070
Kidney Neoplasms	Associate	27029070
Neoplasms	Associate	15067011, 16887812, 23241165, 27029070
Osteosarcoma	Associate	31173206
Ovarian Neoplasms	Associate	28591191
Squamous Cell Carcinoma of Head and Neck	Associate	23241165