Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9540
Gene name Gene Name - the full gene name approved by the HGNC.	Tumor protein p53 inducible protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TP53I3
Synonyms (NCBI Gene) Gene synonyms aliases	PIG3
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p23.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell dea

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016254	hsa-miR-504-5p	qRT-PCR	20542001
MIRT029187	hsa-miR-26b-5p	Microarray	19088304
MIRT1448270	hsa-miR-1257	CLIP-seq
MIRT1448271	hsa-miR-1299	CLIP-seq
MIRT1448272	hsa-miR-3194-3p	CLIP-seq
MIRT1448273	hsa-miR-3611	CLIP-seq
MIRT1448274	hsa-miR-3925-3p	CLIP-seq
MIRT1448275	hsa-miR-3978	CLIP-seq
MIRT1448276	hsa-miR-4421	CLIP-seq
MIRT1448277	hsa-miR-4464	CLIP-seq
MIRT1448278	hsa-miR-4748	CLIP-seq
MIRT1448279	hsa-miR-4796-5p	CLIP-seq
MIRT1448280	hsa-miR-515-5p	CLIP-seq
MIRT1448281	hsa-miR-578	CLIP-seq
MIRT1448282	hsa-miR-766	CLIP-seq
MIRT1448283	hsa-miR-875-3p	CLIP-seq
MIRT1448284	hsa-miR-942	CLIP-seq
MIRT1448276	hsa-miR-4421	CLIP-seq
MIRT1448279	hsa-miR-4796-5p	CLIP-seq
MIRT1448281	hsa-miR-578	CLIP-seq
MIRT2462179	hsa-miR-516b	CLIP-seq
MIRT2462180	hsa-miR-760	CLIP-seq
MIRT2462181	hsa-miR-765	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
TP53	Activation	10101800;14695213
TP53	Unknown	12851404

Show/Hide all(10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003960	Function	NADPH:quinone reductase activity	IBA	21873635
GO:0003960	Function	NADPH:quinone reductase activity	IDA	19349281
GO:0005829	Component	Cytosol	TAS
GO:0006739	Process	NADP metabolic process	IDA	19349281
GO:0042803	Function	Protein homodimerization activity	IPI	19349281
GO:0042981	Process	Regulation of apoptotic process	TAS
GO:0048038	Function	Quinone binding	IBA	21873635
GO:0048038	Function	Quinone binding	IDA	19349281
GO:0070402	Function	NADPH binding	IBA	21873635
GO:0070402	Function	NADPH binding	IDA	19349281

MIM	HGNC	e!Ensembl
605171	19373	ENSG00000115129

Protein

UniProt ID

Q53FA7

Protein name

Quinone oxidoreductase PIG3 (EC 1.6.5.5) (NADPH:quinone reductase PIG3) (Tumor protein p53-inducible protein 3) (Protein PIG3) (p53-induced gene 3 protein)

Protein function

Catalyzes the NADPH-dependent reduction of quinones (PubMed:19349281). Exhibits a low enzymatic activity with beta-naphthoquinones, with a strong preference for the ortho-quinone isomer (1,2-beta-naphthoquinone) over the para isomer (1,4-beta-na

PDB

2J8Z , 2OBY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08240	ADH_N	27 → 91	Alcohol dehydrogenase GroES-like domain	Domain
PF00107	ADH_zinc_N	152 → 283	Zinc-binding dehydrogenase	Family

Sequence

MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNI
LGLEASGHVAELGPGCQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAA
IPEAWLTAFQLLHLVGNVQAGDYVLIHAGLSGVGTAAIQLTRMAGAIPLVTAGSQKKLQM
AEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWVLYGL
MGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

Sequence length

332

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway		TP53 regulates transcription of several additional cell death genes whose specific roles in p53-dependent apoptosis remain uncertain

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)
Carcinoma	Carcinoma, Carcinoma, Spindle-Cell, Undifferentiated carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	21489049

Show/Hide Text Mining Associations (9)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	34362378
Breast Neoplasms	Associate	25797244, 27111245
Carcinoma Non Small Cell Lung	Associate	28259183
Carcinoma Renal Cell	Associate	27029070
Kidney Neoplasms	Associate	27029070
Neoplasms	Associate	15067011, 16887812, 23241165, 27029070
Osteosarcoma	Associate	31173206
Ovarian Neoplasms	Associate	28591191
Squamous Cell Carcinoma of Head and Neck	Associate	23241165

TP53I3 (tumor protein p53 inducible protein 3)