Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9531
Gene name Gene Name - the full gene name approved by the HGNC.	BAG cochaperone 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	BAG3
Synonyms (NCBI Gene) Gene synonyms aliases	BAG-3, BIS, CAIR-1, CMD1HH, CMT2JJ, HMND15, MFM6
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.11
Summary Summary of gene provided in NCBI Entrez Gene.	BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The protein

Show/Hide all(53)

SNP ID	Visualize variation	Clinical significance	Consequence
rs117749531	G>A,T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign, likely-pathogenic	Stop gained, missense variant, coding sequence variant
rs121918312	C>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs143919208	C>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Missense variant, coding sequence variant
rs145393807	A>T	Conflicting-interpretations-of-pathogenicity, uncertain-significance, benign, likely-benign	Missense variant, coding sequence variant
rs151331972	C>A,G,T	Conflicting-interpretations-of-pathogenicity, benign	Coding sequence variant, missense variant, synonymous variant
rs199682693	C>G,T	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs200212999	C>G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs201638005	G>A,T	Likely-benign, conflicting-interpretations-of-pathogenicity, uncertain-significance	Coding sequence variant, missense variant
rs387906874	C>T	Likely-benign, uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs387906875	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, stop gained
rs387906876	G>A	Pathogenic	Coding sequence variant, missense variant
rs397514506	C>T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs397514507	T>C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs397516881	G>A	Pathogenic-likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs727502897	C>-,CC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs727505109	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs727505283	ACCGGCTG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs730880055	C>T	Likely-pathogenic	Coding sequence variant, stop gained
rs751261054	C>A,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs775151738	A>G	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, synonymous variant
rs786205466	G>A,C	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs794728981	CTGAAAGTGG>-	Pathogenic	Coding sequence variant, frameshift variant
rs869025365	G>A	Likely-pathogenic	Splice donor variant
rs869248137	C>A,T	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs876657634	C>T	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs876661342	C>A	Pathogenic	Stop gained, coding sequence variant
rs886039044	C>T	Pathogenic	Stop gained, coding sequence variant
rs886039182	->A	Pathogenic	Coding sequence variant, frameshift variant
rs1057517945	C>T	Pathogenic	Stop gained, coding sequence variant
rs1057518511	->GCCAC	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1060502815	A>G,T	Likely-pathogenic	Stop gained, missense variant, coding sequence variant
rs1064795700	A>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1135402750	->T	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1473083093	C>A	Likely-pathogenic	Stop gained, coding sequence variant
rs1554875409	G>A	Pathogenic, likely-pathogenic	Stop gained, coding sequence variant
rs1554876984	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1554876999	C>G	Likely-pathogenic	Stop gained, coding sequence variant
rs1554877001	C>T	Pathogenic	Stop gained, coding sequence variant
rs1554877037	->C	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1554877224	->C	Pathogenic	Frameshift variant, coding sequence variant
rs1554877731	AGGTG>-	Pathogenic	Frameshift variant, coding sequence variant
rs1554877765	->C	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1564767043	G>A	Pathogenic	Stop gained, coding sequence variant
rs1564773559	->TGTGTAC	Pathogenic	Frameshift variant, coding sequence variant
rs1564773589	->T	Pathogenic	Frameshift variant, coding sequence variant
rs1564774433	C>A	Pathogenic	Stop gained, coding sequence variant
rs1589628864	C>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1589630001	C>T	Pathogenic	Coding sequence variant, stop gained
rs1589630130	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1589630141	C>T	Pathogenic	Coding sequence variant, missense variant
rs1589630173	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs1589632398	TAAG>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1589632876	->G	Likely-pathogenic	Frameshift variant, coding sequence variant

Show/Hide all(103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029481	hsa-miR-26b-5p	Microarray	19088304
MIRT046955	hsa-miR-221-3p	CLASH	23622248
MIRT814539	hsa-miR-1283	CLIP-seq
MIRT814540	hsa-miR-129-3p	CLIP-seq
MIRT814541	hsa-miR-140-3p	CLIP-seq
MIRT814542	hsa-miR-148a	CLIP-seq
MIRT814543	hsa-miR-148b	CLIP-seq
MIRT814544	hsa-miR-152	CLIP-seq
MIRT814545	hsa-miR-198	CLIP-seq
MIRT814546	hsa-miR-2052	CLIP-seq
MIRT814547	hsa-miR-298	CLIP-seq
MIRT814548	hsa-miR-3158-5p	CLIP-seq
MIRT814549	hsa-miR-342-5p	CLIP-seq
MIRT814550	hsa-miR-3591-5p	CLIP-seq
MIRT814551	hsa-miR-371-5p	CLIP-seq
MIRT814552	hsa-miR-371b-5p	CLIP-seq
MIRT814553	hsa-miR-3925-3p	CLIP-seq
MIRT814554	hsa-miR-411	CLIP-seq
MIRT814555	hsa-miR-4255	CLIP-seq
MIRT814556	hsa-miR-4422	CLIP-seq
MIRT814557	hsa-miR-4446-3p	CLIP-seq
MIRT814558	hsa-miR-4447	CLIP-seq
MIRT814559	hsa-miR-4472	CLIP-seq
MIRT814560	hsa-miR-455-3p	CLIP-seq
MIRT814561	hsa-miR-4664-5p	CLIP-seq
MIRT814562	hsa-miR-4687-5p	CLIP-seq
MIRT814563	hsa-miR-513c	CLIP-seq
MIRT814564	hsa-miR-514b-5p	CLIP-seq
MIRT814565	hsa-miR-520a-5p	CLIP-seq
MIRT814566	hsa-miR-525-5p	CLIP-seq
MIRT814567	hsa-miR-541	CLIP-seq
MIRT814568	hsa-miR-552	CLIP-seq
MIRT814569	hsa-miR-654-5p	CLIP-seq
MIRT1940800	hsa-miR-1179	CLIP-seq
MIRT1940801	hsa-miR-1273f	CLIP-seq
MIRT814539	hsa-miR-1283	CLIP-seq
MIRT1940802	hsa-miR-135a	CLIP-seq
MIRT1940803	hsa-miR-135b	CLIP-seq
MIRT814541	hsa-miR-140-3p	CLIP-seq
MIRT1940804	hsa-miR-143	CLIP-seq
MIRT814542	hsa-miR-148a	CLIP-seq
MIRT814543	hsa-miR-148b	CLIP-seq
MIRT814544	hsa-miR-152	CLIP-seq
MIRT814545	hsa-miR-198	CLIP-seq
MIRT1940805	hsa-miR-203	CLIP-seq
MIRT814547	hsa-miR-298	CLIP-seq
MIRT814548	hsa-miR-3158-5p	CLIP-seq
MIRT1940806	hsa-miR-337-3p	CLIP-seq
MIRT814549	hsa-miR-342-5p	CLIP-seq
MIRT1940807	hsa-miR-3662	CLIP-seq
MIRT1940808	hsa-miR-3921	CLIP-seq
MIRT814553	hsa-miR-3925-3p	CLIP-seq
MIRT814554	hsa-miR-411	CLIP-seq
MIRT814557	hsa-miR-4446-3p	CLIP-seq
MIRT814558	hsa-miR-4447	CLIP-seq
MIRT814559	hsa-miR-4472	CLIP-seq
MIRT1940809	hsa-miR-4509	CLIP-seq
MIRT814560	hsa-miR-455-3p	CLIP-seq
MIRT1940810	hsa-miR-4653-5p	CLIP-seq
MIRT814561	hsa-miR-4664-5p	CLIP-seq
MIRT1940811	hsa-miR-4678	CLIP-seq
MIRT1940812	hsa-miR-4708-5p	CLIP-seq
MIRT1940813	hsa-miR-4712-3p	CLIP-seq
MIRT1940814	hsa-miR-4744	CLIP-seq
MIRT1940815	hsa-miR-4766-5p	CLIP-seq
MIRT1940816	hsa-miR-4770	CLIP-seq
MIRT814565	hsa-miR-520a-5p	CLIP-seq
MIRT814566	hsa-miR-525-5p	CLIP-seq
MIRT814567	hsa-miR-541	CLIP-seq
MIRT1940817	hsa-miR-548aa	CLIP-seq
MIRT1940818	hsa-miR-548ac	CLIP-seq
MIRT1940819	hsa-miR-548ae	CLIP-seq
MIRT1940820	hsa-miR-548aj	CLIP-seq
MIRT1940821	hsa-miR-548am	CLIP-seq
MIRT1940822	hsa-miR-548d-3p	CLIP-seq
MIRT1940823	hsa-miR-548x	CLIP-seq
MIRT1940824	hsa-miR-548z	CLIP-seq
MIRT814568	hsa-miR-552	CLIP-seq
MIRT1940825	hsa-miR-593	CLIP-seq
MIRT1940826	hsa-miR-646	CLIP-seq
MIRT814569	hsa-miR-654-5p	CLIP-seq
MIRT1940827	hsa-miR-891b	CLIP-seq
MIRT1940828	hsa-miR-944	CLIP-seq
MIRT814546	hsa-miR-2052	CLIP-seq
MIRT2179832	hsa-miR-3152-5p	CLIP-seq
MIRT2179833	hsa-miR-4774-3p	CLIP-seq
MIRT814542	hsa-miR-148a	CLIP-seq
MIRT814543	hsa-miR-148b	CLIP-seq
MIRT814544	hsa-miR-152	CLIP-seq
MIRT1940801	hsa-miR-1273f	CLIP-seq
MIRT1940804	hsa-miR-143	CLIP-seq
MIRT2483279	hsa-miR-3185	CLIP-seq
MIRT1940809	hsa-miR-4509	CLIP-seq
MIRT1940811	hsa-miR-4678	CLIP-seq
MIRT1940812	hsa-miR-4708-5p	CLIP-seq
MIRT1940813	hsa-miR-4712-3p	CLIP-seq
MIRT1940814	hsa-miR-4744	CLIP-seq
MIRT1940816	hsa-miR-4770	CLIP-seq
MIRT1940828	hsa-miR-944	CLIP-seq
MIRT1940809	hsa-miR-4509	CLIP-seq
MIRT1940811	hsa-miR-4678	CLIP-seq
MIRT1940814	hsa-miR-4744	CLIP-seq
MIRT1940828	hsa-miR-944	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
GTF3A	Activation	19282432
HSF1	Repression	19006120
HSF1	Unknown	20692357

Show/Hide all(61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IEA
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IBA
GO:0000774	Function	Adenyl-nucleotide exchange factor activity	IDA	20060297, 24318877, 30559338
GO:0001725	Component	Stress fiber	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 19229298, 21044950, 21516116, 22366786, 23434281, 24318877, 24510904, 25036637, 25277244, 25416956, 26159920, 26496610, 27880917, 28144995, 28514442, 31515488, 32296183, 32707033, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	26159920
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	26159920
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	10597216
GO:0005829	Component	Cytosol	TAS
GO:0006457	Process	Protein folding	IDA	30559338
GO:0006457	Process	Protein folding	NAS	9873016
GO:0006915	Process	Apoptotic process	IEA
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	IDA	10597216
GO:0010658	Process	Striated muscle cell apoptotic process	IEA
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	IBA
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	IEA
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	IEA
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	IMP	19085932
GO:0016020	Component	Membrane	IBA
GO:0016235	Component	Aggresome	TAS	21681022
GO:0021510	Process	Spinal cord development	IEA
GO:0030018	Component	Z disc	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	27884606
GO:0034605	Process	Cellular response to heat	IDA	26159920
GO:0034620	Process	Cellular response to unfolded protein	IMP	18006506
GO:0036064	Component	Ciliary basal body	IDA
GO:0042307	Process	Positive regulation of protein import into nucleus	IMP	26159920
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	10597216
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045505	Function	Dynein intermediate chain binding	NAS	21252941
GO:0046716	Process	Muscle cell cellular homeostasis	IBA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IMP	19085932
GO:0046827	Process	Positive regulation of protein export from nucleus	IMP	26159920
GO:0050821	Process	Protein stabilization	IBA
GO:0050821	Process	Protein stabilization	IDA	18006506
GO:0050821	Process	Protein stabilization	IEA
GO:0050821	Process	Protein stabilization	IEA
GO:0051087	Function	Protein-folding chaperone binding	IBA
GO:0051087	Function	Protein-folding chaperone binding	IDA	27884606, 30559338
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051087	Function	Protein-folding chaperone binding	IPI	18006506
GO:0061684	Process	Chaperone-mediated autophagy	IEA
GO:0070842	Process	Aggresome assembly	TAS	21681022
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0097191	Process	Extrinsic apoptotic signaling pathway	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0098840	Process	Protein transport along microtubule	TAS	21681022
GO:0101031	Component	Protein folding chaperone complex	IDA	18006506
GO:0140597	Function	Protein carrier chaperone	TAS	21681022
GO:1903215	Process	Negative regulation of protein targeting to mitochondrion	IEA
GO:1905337	Process	Positive regulation of aggrephagy	IMP	18006506

MIM	HGNC	e!Ensembl
603883	939	ENSG00000151929

Protein

UniProt ID

O95817

Protein name

BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1)

Protein function

Co-chaperone and adapter protein that connects different classes of molecular chaperones including heat shock proteins 70 (HSP70s), e.g. HSPA1A/HSP70 or HSPA8/HSC70, and small heat shock proteins (sHSPs), e.g. HSPB8 (PubMed:27884606, PubMed:3055

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00397	WW	22 → 52	WW domain	Domain
PF02179	BAG	425 → 497	BAG domain	Family

Sequence

MSAATHSPMMQVASGNGDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPSEGPK
ETPSSANGPSREGSRLPPAREGHPVYPQLRPGYIPIPVLHEGAENRQVHPFHVYPQPGMQ
RFRTEAAAAAPQRSQSPLRGMPETTQPDKQCGQVAAAAAAQPPASHGPERSQSPAASDCS
SSSSSASLPSSGRSSLGSHQLPRGYISIPVIHEQNVTRPAAQPSFHQAQKTHYPAQQGEY
QTHQPVYHKIQGDDWEPRPLRAASPFRSSVQGASSREGSPARSSTPLHSPSPIRVHTVVD
RPQQPMTHRETAPVSQPENKPESKPGPVGPELPPGHIPIQVIRKEVDSKPVSQKPPPPSE
KVEVKVPPAPVPCPPPSPGPSAVPSSPKSVATEERAAPSTAPAEATPPKPGEAEAPPKHP
GVLKVEAILEKVQGLEQAVDNFEGKKTDKKYLMIEEYLTKELLALDSVDPEGRADVRQAR
RDGVRKVQTILEKLEQKAIDVPGQVQVYELQPSNLEADQPLQAIMEMGAVAADKGKKNAG
NAEDPHTETQQPEATAAATSNPSSMTDTPGNPAAP

Sequence length

575

Interactions

View interactions

	Reactome
			Regulation of HSF1-mediated heat shock response

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Cardiomyopathy	Primary dilated cardiomyopathy, Primary familial dilated cardiomyopathy	rs869025365, rs1589632398, rs876657634, rs869248137, rs387906875, rs751261054, rs397516881, rs727505283, rs1554875409, rs727505109, rs727502897, rs1564773559, rs730880055	N/A
Dilated Cardiomyopathy	Dilated cardiomyopathy 1HH	rs1589632876, rs1847236575, rs387906875, rs869248137, rs1589630173, rs1554877224, rs397514507, rs1135402750, rs1554875409	N/A
Peripheral Neuropathy	peripheral neuropathy	rs121918312	N/A

Show/Hide Unknown Diseases (9)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Arrhythmogenic right ventricular cardiomyopathy	Familial isolated arrhythmogenic right ventricular dysplasia	N/A	N/A	ClinVar
Atrial Fibrillation	atrial fibrillation	N/A	N/A	ClinVar
Charcot-Marie-Tooth Disease	Charcot-Marie-tooth disease, axonal, type 2JJ	N/A	N/A	GenCC
Heart Failure	Heart failure	N/A	N/A	GWAS
Hypertrophic cardiomyopathy	hypertrophic cardiomyopathy, Hypertrophic cardiomyopathy	N/A	N/A	ClinVar, GWAS
Hypertrophic Cardiomyopathy	Primary familial hypertrophic cardiomyopathy	N/A	N/A	ClinVar
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar
Myofibrillar myopathy	myofibrillar myopathy 6, myofibrillar myopathy	N/A	N/A	GenCC
Neuropathy	distal hereditary motor neuropathy	N/A	N/A	GenCC

Show/Hide Text Mining Associations (100)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alcoholic Neuropathy	Associate	20605452, 27443559
Alzheimer Disease	Associate	35008592, 37536287
Amyotrophic Lateral Sclerosis	Associate	27570075
Anodontia	Associate	31444794
Anophthalmia with pulmonary hypoplasia	Associate	31119886
Arrhythmias Cardiac	Associate	30442290, 35205406
Atrial Fibrillation	Associate	35205406
Atrioventricular Block	Associate	35205406
Blood Platelet Disorders	Associate	34741638
Brain Diseases	Associate	17187345, 38212812
Breast Neoplasms	Inhibit	12750378
Breast Neoplasms	Associate	19402132, 24080088, 24997994, 25417742, 28703799, 29462756, 36228497, 37377218
Carcinogenesis	Associate	34215846, 37377218
Carcinoma Hepatocellular	Associate	24895585, 26621836
Carcinoma Pancreatic Ductal	Associate	22944597, 30154469, 30771383, 31119886, 35406724
Carcinoma Renal Cell	Associate	38297320
Cardiomyopathies	Associate	26512958, 26545904, 27443559, 28359509, 28669108, 30442290, 33874732, 35029900, 35047758, 36560844
Cardiomyopathy Dilated	Associate	21459883, 24623017, 25008357, 28296976, 28669108, 29961767, 30442290, 30792263, 31723063, 31983221, 32032554, 32472079, 32916098, 33874732, 33947203 View all (7 more)
Cardiomyopathy Hypertrophic	Associate	35047758
Cardiomyopathy Restrictive	Associate	26545904, 36560844, 39662461, 39662463, 39729860
Charcot Marie Tooth disease X linked recessive 2	Associate	32472079
Chondrosarcoma	Stimulate	29484408
Colorectal Neoplasms	Associate	23983126, 26577854, 30081850
Coronary Artery Disease	Associate	35964012
COVID 19	Associate	34741638
Cystic Fibrosis	Associate	29986884
Deafness	Associate	25208129
Death	Associate	30442290, 38183888
Death Sudden Cardiac	Associate	28669108
Diabetes Mellitus Type 2	Associate	26337083
Distal Myopathies	Associate	32472079
Drug Related Side Effects and Adverse Reactions	Stimulate	24080088
Encephalitis Herpes Simplex	Associate	35029900
Endometrial Neoplasms	Associate	37377218
Epstein Barr Virus Infections	Associate	19088197
Fabry Disease	Associate	37914990
familial dilated cardiomyopathy	Associate	21459883, 27391596, 28296976, 30792263, 32032554, 34498126
Fibrosis	Stimulate	25361773
Fibrosis	Associate	25361773, 31119886, 39744939
Glioblastoma	Associate	25204229, 25483098, 27145367
Glioma	Associate	19777443, 24080088, 25204229
Gliosis	Associate	35008592
Glomerulonephritis IGA	Associate	37914990
Heart Diseases	Associate	26464484, 39744939
Heart Failure	Inhibit	24623017
Heart Failure	Associate	28359509, 31554410, 35205406, 35964012, 36642055, 38183888, 39662461, 39662463
Hepatic Encephalopathy	Associate	38212812
Hernias Diaphragmatic Congenital	Associate	35029900
Idiopathic Noncirrhotic Portal Hypertension	Associate	38212812
Immune System Diseases	Associate	37070487
Infections	Associate	25008357
Inflammation	Associate	34741638
Intervertebral Disc Degeneration	Associate	26545904
Kidney Neoplasms	Associate	19681889
Kyphoscoliosis 1	Associate	35047758
Lesch Nyhan Syndrome	Associate	31444794
Leukemia Myeloid Acute	Associate	37070487, 39650664
Long QT Syndrome	Associate	26545904
Lymphoma T Cell	Associate	24492285
Medulloblastoma	Associate	27456361
Muscle Weakness	Associate	26545904, 39662461, 39662463
Muscular Diseases	Associate	21683594, 26545904, 26718575, 30559338, 32472079, 33158300
Muscular Dystrophies	Associate	20001957, 21683594, 31723063
Muscular Dystrophy Duchenne	Associate	37671549
Myocarditis	Associate	28359509
Myofibrillar Myopathy	Associate	20605452, 21676617, 22106715, 25208129, 26718575, 26847086, 27443559, 27618136, 35029900, 35047758, 39662461, 39662463, 39729860, 39973468
Myopathy Myofibrillar Zasp Related	Associate	27443559, 35029900
Myopathy Myosin Storage	Associate	30442290
Neoplasm Metastasis	Associate	19402132, 24577090, 35163936, 37377218
Neoplasm Metastasis	Stimulate	26577854, 38369185
Neoplasms	Associate	20535599, 23341456, 23448667, 23983126, 24080088, 24895585, 25175321, 26577854, 27145367, 29445088, 30081850, 30771383, 30910998, 31119886, 33158300 View all (5 more)
Neoplasms	Inhibit	26621836
Nervous System Diseases	Associate	26545904, 32472079
Neuroblastoma	Associate	25361773
Neurodegenerative Diseases	Associate	33158300, 35008592
Ovarian Neoplasms	Stimulate	34111434
Ovarian Neoplasms	Associate	35935940, 37377218
Pain	Associate	37914990
Pancreatic Neoplasms	Associate	11513873, 22944597, 26337083, 30154469, 30771383, 31657880
Pancreatitis	Associate	31119886
Parkinson Disease	Associate	30957308, 40715263
Peripheral Nervous System Diseases	Associate	39973468
Polyneuropathies	Associate	25208129, 26545904, 35047758, 39662461, 39662463
Prostate cancer familial	Inhibit	37377218
Prostatic Neoplasms	Associate	20535599, 23341456, 36891298
Prostatitis	Associate	20535599
Pulmonary Disease Chronic Obstructive	Associate	33469280
Respiratory Insufficiency	Associate	25208129, 26545904, 35029900, 35047758
Respiratory Paralysis	Associate	35029900
Retinal Dysplasia	Associate	31444794
Rhabdomyosarcoma	Associate	25766331
Rigid spine syndrome	Associate	27443559
Squamous Intraepithelial Lesions of the Cervix	Associate	31444794
T cell immunodeficiency primary	Associate	37070487
Takotsubo Cardiomyopathy	Associate	26512958, 29514624
Thyroid Neoplasms	Associate	24080088, 24577090
Triple Negative Breast Neoplasms	Associate	29462756
Ureteral Obstruction	Stimulate	25361773
Uterine Cervical Neoplasms	Associate	25175321, 31444794, 37377218
Virus Diseases	Associate	17187345, 24577090

BAG3 (BAG cochaperone 3)