GDF15 (growth differentiation factor 15)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9518
Gene name Growth differentiation factor 15
Gene symbol GDF15
Synonyms (NCBI Gene)
GDF-15HGMIC-1MIC1NAG-1PDFPLABPTGFB
Chromosome 19
Chromosome location 19p13.11
Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate
miRNA miRNA information provided by mirtarbase database.
20
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (20)
miRTarBase ID miRNA Experiments Reference
MIRT018703 hsa-miR-335-5p Microarray 18185580
MIRT1015716 hsa-miR-128 CLIP-seq
MIRT1015717 hsa-miR-3190 CLIP-seq
MIRT1015718 hsa-miR-3202 CLIP-seq
MIRT1015719 hsa-miR-4533 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
11
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
Transcription factor Regulation Reference
ATF3 Activation 15670751
CEBPB Activation 24086573
EGR1 Activation 17715378
EGR1 Unknown 14662774
KLF4 Repression 22750490
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
50
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (50)
GO ID Ontology Definition Evidence Reference
GO:0002023 Process Reduction of food intake in response to dietary excess IDA 28846097, 28846098, 28846099, 28953886, 29046435
GO:0002023 Process Reduction of food intake in response to dietary excess IEA
GO:0002686 Process Negative regulation of leukocyte migration IEA
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IDA 38092039
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605312 30142 ENSG00000130513
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99988
Protein name Growth/differentiation factor 15 (GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1) (NSAID-activated gene 1 protein) (NAG-1) (NSAID-regulated gene 1 protein) (NRG-1) (Placental TGF-beta) (Placental bone morphogenetic protein) (Prostate differentiation fa
Protein function Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed:23468844, PubMed:24971956, PubMed:2884
PDB 5VT2 , 5VZ3 , 5VZ4 , 6Q2J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 210 → 307 Transforming growth factor beta like domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in plasma (at protein level) (PubMed:28572090, PubMed:29046435). Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney (PubMed:37060902, PubMed:9348093). {ECO:0000269|PubMed:285720
Sequence 
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG 
  Cytokine-cytokine receptor interaction  
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Hyperemesis gravidarum, susceptibility to risk factor rs372120002 RCV003881729
Show/Hide Text Mining Associations (252)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 28411246
Acute Kidney Injury Associate 20357380, 31163432
Addison Disease Stimulate 31853550
Adenocarcinoma Associate 22384099, 25867265
Adenocarcinoma of Lung Associate 24377518, 37322027
Alagille Syndrome Stimulate 38180987
alpha 1 Antitrypsin Deficiency Stimulate 38180987
Alveolitis Extrinsic Allergic Associate 38195721
Alzheimer Disease Associate 36050589
Amputation Congenital Stimulate 28855167