GDF15 (growth differentiation factor 15)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9518
Gene name Gene Name - the full gene name approved by the HGNC.
Growth differentiation factor 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GDF15
Synonyms (NCBI Gene) Gene synonyms aliases
GDF-15, HG, MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Disease Acronyms (UniProt) Disease acronyms from UniProt database
HG
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(20)
miRTarBase ID miRNA Experiments Reference
MIRT018703 hsa-miR-335-5p Microarray 18185580
MIRT1015716 hsa-miR-128 CLIP-seq
MIRT1015717 hsa-miR-3190 CLIP-seq
MIRT1015718 hsa-miR-3202 CLIP-seq
MIRT1015719 hsa-miR-4533 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
Transcription factor Regulation Reference
ATF3 Activation 15670751
CEBPB Activation 24086573
EGR1 Activation 17715378
EGR1 Unknown 14662774
KLF4 Repression 22750490
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(29)
GO ID Ontology Definition Evidence Reference
GO:0000187 Process Activation of MAPK activity IDA 28953886
GO:0002023 Process Reduction of food intake in response to dietary excess IDA 28846097, 28846098, 28846099, 28953886, 29046435
GO:0005125 Function Cytokine activity IBA 21873635
GO:0005515 Function Protein binding IPI 19060904, 25893289, 28846098, 28846099, 28953886, 32296183
GO:0005576 Component Extracellular region IDA 28572090, 29046435
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605312 30142 ENSG00000130513
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q99988
Protein name Growth/differentiation factor 15 (GDF-15) (Macrophage inhibitory cytokine 1) (MIC-1) (NSAID-activated gene 1 protein) (NAG-1) (NSAID-regulated gene 1 protein) (NRG-1) (Placental TGF-beta) (Placental bone morphogenetic protein) (Prostate differentiation fa
Protein function Hormone produced in response to various stresses to confer information about those stresses to the brain, and trigger an aversive response, characterized by nausea, vomiting, and/or loss of appetite (PubMed:23468844, PubMed:24971956, PubMed:2884
PDB 5VT2 , 5VZ3 , 5VZ4 , 6Q2J
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00019 TGF_beta 210 → 307 Transforming growth factor beta like domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in plasma (at protein level) (PubMed:28572090, PubMed:29046435). Highly expressed in placenta, with lower levels in prostate and colon and some expression in kidney (PubMed:37060902, PubMed:9348093). {ECO:0000269|PubMed:285720
Sequence 
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRY
EDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRL
HRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQL
ELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC
IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDL
LAKDCHCI
Sequence length 308
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  
  Cytokine-cytokine receptor interaction  
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Coronary artery disease Coronary Artery Disease rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537 20855664
Left ventricular hypertrophy Left Ventricular Hypertrophy rs397516037 19505289
Melanoma melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 17145863
Prostate cancer Malignant neoplasm of prostate rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582 23996089, 16775185
Show/Hide Unknown Diseases (6)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 20855664 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 20855664 ClinVar
Myocardial infarction Myocardial Failure 20855664 ClinVar
Systemic lupus erythematosus Systemic lupus erythematosus GWAS
Show/Hide Text Mining Associations (252)
Associations from Text Mining
Disease Name Relationship Type References
Acute Coronary Syndrome Associate 28411246
Acute Kidney Injury Associate 20357380, 31163432
Addison Disease Stimulate 31853550
Adenocarcinoma Associate 22384099, 25867265
Adenocarcinoma of Lung Associate 24377518, 37322027
Alagille Syndrome Stimulate 38180987
alpha 1 Antitrypsin Deficiency Stimulate 38180987
Alveolitis Extrinsic Allergic Associate 38195721
Alzheimer Disease Associate 36050589
Amputation Congenital Stimulate 28855167