CD37 (CD37 molecule)

Gene

• Entrez ID: 951
• Gene name: CD37 molecule
• Gene symbol: CD37
• Synonyms (NCBI Gene): GP52-40, TSPAN26
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018777	hsa-miR-335-5p	Microarray	18185580
MIRT875214	hsa-miR-1293	CLIP-seq
MIRT875215	hsa-miR-3144-5p	CLIP-seq
MIRT875216	hsa-miR-3191	CLIP-seq
MIRT875217	hsa-miR-4265	CLIP-seq
MIRT875218	hsa-miR-4296	CLIP-seq
MIRT875219	hsa-miR-4322	CLIP-seq
MIRT875220	hsa-miR-4483	CLIP-seq
MIRT875221	hsa-miR-4652-5p	CLIP-seq
MIRT875222	hsa-miR-581	CLIP-seq
MIRT875223	hsa-miR-1908	CLIP-seq
MIRT875224	hsa-miR-2110	CLIP-seq
MIRT875225	hsa-miR-3141	CLIP-seq
MIRT875226	hsa-miR-3150a-3p	CLIP-seq
MIRT875227	hsa-miR-3175	CLIP-seq
MIRT875228	hsa-miR-4260	CLIP-seq
MIRT875229	hsa-miR-4728-5p	CLIP-seq
MIRT875230	hsa-miR-663	CLIP-seq
MIRT875231	hsa-miR-744	CLIP-seq
MIRT875232	hsa-miR-939	CLIP-seq
MIRT875223	hsa-miR-1908	CLIP-seq
MIRT875224	hsa-miR-2110	CLIP-seq
MIRT875226	hsa-miR-3150a-3p	CLIP-seq
MIRT875227	hsa-miR-3175	CLIP-seq
MIRT1959490	hsa-miR-3180	CLIP-seq
MIRT1959491	hsa-miR-3180-3p	CLIP-seq
MIRT1959492	hsa-miR-3196	CLIP-seq
MIRT875228	hsa-miR-4260	CLIP-seq
MIRT875229	hsa-miR-4728-5p	CLIP-seq
MIRT875230	hsa-miR-663	CLIP-seq
MIRT875231	hsa-miR-744	CLIP-seq
MIRT875232	hsa-miR-939	CLIP-seq
MIRT2196470	hsa-miR-15a	CLIP-seq
MIRT2196471	hsa-miR-15b	CLIP-seq
MIRT2196472	hsa-miR-16	CLIP-seq
MIRT2196473	hsa-miR-1909	CLIP-seq
MIRT2196474	hsa-miR-195	CLIP-seq
MIRT2196475	hsa-miR-214	CLIP-seq
MIRT2196476	hsa-miR-2277-3p	CLIP-seq
MIRT2196477	hsa-miR-3619-5p	CLIP-seq
MIRT2196478	hsa-miR-424	CLIP-seq
MIRT2196479	hsa-miR-4688	CLIP-seq
MIRT2196480	hsa-miR-4691-3p	CLIP-seq
MIRT2196481	hsa-miR-497	CLIP-seq
MIRT2196482	hsa-miR-542-3p	CLIP-seq
MIRT2196483	hsa-miR-761	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001772	Component	Immunological synapse	IDA	21930792
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002920	Process	Regulation of humoral immune response	IEA
GO:0005515	Function	Protein binding	IPI	21930792, 22624718, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0050688	Process	Regulation of defense response to virus	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337

Other IDs

• MIM: 151523
• HGNC: 1666
• e!Ensembl: ENSG00000104894

Protein

• UniProt ID: P11049
• Protein name: Leukocyte antigen CD37 (Tetraspanin-26) (Tspan-26) (CD antigen CD37)
• Protein function: Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Participates thereby in diverse biological functions such as cell signal
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00335	Tetraspanin	11 → 269	Tetraspanin family	Family

• Tissue specificity: TISSUE SPECIFICITY: B-lymphocytes (PubMed:26784544). Antigen presenting cells (PubMed:17182550). {ECO:0000269|PubMed:17182550, ECO:0000269|PubMed:26784544}.
• Sequence:

  MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
  LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR
  DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS
  CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
  NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR

• Sequence length: 281

Pathways

KEGG:

Hematopoietic cell lineage

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Inhibit	32616892	★☆☆☆☆ Found in Text Mining only
Anemia hypochromic microcytic	Associate	19359777	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Associate	12406100	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Associate	9136941	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	30854931	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	35120331	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Associate	20118909	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	31381571	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	37274903	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	30792198	★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Stimulate	30792198	★☆☆☆☆ Found in Text Mining only
Erectile Dysfunction	Associate	25343742	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	24952935	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Stimulate	30792198	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Associate	30792198	★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	35528167	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	25833959, 30792198	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Stimulate	32400873	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	35528167, 38186215	★☆☆☆☆ Found in Text Mining only
Liver Failure	Associate	35726350	★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	24952935, 31366619	★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	27760757, 31366619, 35086136	★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Associate	20427703	★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	35086136, 35486574	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Associate	38035078	★☆☆☆☆ Found in Text Mining only
Neoplasm Metastasis	Associate	30854931	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	20118909, 30792198, 32400873, 9737661	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	27760757	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	37284741	★☆☆☆☆ Found in Text Mining only