Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9498
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 4 member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC4A8
Synonyms (NCBI Gene) Gene synonyms aliases	NBC3, NDCBE
Chromosome Chromosome number	12
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	12q13.13
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4`-D

Show/Hide all(68)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017276	hsa-miR-335-5p	Microarray	18185580
MIRT1365230	hsa-miR-1207-5p	CLIP-seq
MIRT1365231	hsa-miR-1272	CLIP-seq
MIRT1365232	hsa-miR-1299	CLIP-seq
MIRT1365233	hsa-miR-197	CLIP-seq
MIRT1365234	hsa-miR-3148	CLIP-seq
MIRT1365235	hsa-miR-365	CLIP-seq
MIRT1365236	hsa-miR-3682-3p	CLIP-seq
MIRT1365237	hsa-miR-4269	CLIP-seq
MIRT1365238	hsa-miR-4735-5p	CLIP-seq
MIRT1365239	hsa-miR-4736	CLIP-seq
MIRT1365240	hsa-miR-4747-5p	CLIP-seq
MIRT1365241	hsa-miR-4763-3p	CLIP-seq
MIRT1365242	hsa-miR-5096	CLIP-seq
MIRT1365243	hsa-miR-579	CLIP-seq
MIRT1365244	hsa-miR-582-5p	CLIP-seq
MIRT1365245	hsa-miR-600	CLIP-seq
MIRT1365246	hsa-miR-875-3p	CLIP-seq
MIRT1365247	hsa-miR-1182	CLIP-seq
MIRT1365248	hsa-miR-3674	CLIP-seq
MIRT1365249	hsa-miR-4528	CLIP-seq
MIRT1365250	hsa-miR-4732-5p	CLIP-seq
MIRT2108365	hsa-miR-125a-5p	CLIP-seq
MIRT2108366	hsa-miR-125b	CLIP-seq
MIRT2108367	hsa-miR-134	CLIP-seq
MIRT2108368	hsa-miR-181a	CLIP-seq
MIRT2108369	hsa-miR-181b	CLIP-seq
MIRT2108370	hsa-miR-181c	CLIP-seq
MIRT2108371	hsa-miR-181d	CLIP-seq
MIRT2108372	hsa-miR-1827	CLIP-seq
MIRT2108373	hsa-miR-185	CLIP-seq
MIRT2108374	hsa-miR-3117-5p	CLIP-seq
MIRT2108375	hsa-miR-3118	CLIP-seq
MIRT2108376	hsa-miR-4262	CLIP-seq
MIRT2108377	hsa-miR-4306	CLIP-seq
MIRT2108378	hsa-miR-4319	CLIP-seq
MIRT2108379	hsa-miR-4428	CLIP-seq
MIRT2108380	hsa-miR-4521	CLIP-seq
MIRT2108381	hsa-miR-4644	CLIP-seq
MIRT2108382	hsa-miR-4649-3p	CLIP-seq
MIRT2108383	hsa-miR-4708-5p	CLIP-seq
MIRT2108384	hsa-miR-4732-3p	CLIP-seq
MIRT2108385	hsa-miR-544b	CLIP-seq
MIRT2108386	hsa-miR-670	CLIP-seq
MIRT2108372	hsa-miR-1827	CLIP-seq
MIRT2332157	hsa-miR-3143	CLIP-seq
MIRT2108382	hsa-miR-4649-3p	CLIP-seq
MIRT2459776	hsa-miR-1237	CLIP-seq
MIRT2459777	hsa-miR-1248	CLIP-seq
MIRT2459778	hsa-miR-1267	CLIP-seq
MIRT2459779	hsa-miR-3182	CLIP-seq
MIRT2459780	hsa-miR-4652-3p	CLIP-seq
MIRT2459781	hsa-miR-4684-3p	CLIP-seq
MIRT2108365	hsa-miR-125a-5p	CLIP-seq
MIRT2108366	hsa-miR-125b	CLIP-seq
MIRT2108372	hsa-miR-1827	CLIP-seq
MIRT2626694	hsa-miR-2053	CLIP-seq
MIRT2626695	hsa-miR-3647-3p	CLIP-seq
MIRT2108378	hsa-miR-4319	CLIP-seq
MIRT2626696	hsa-miR-4642	CLIP-seq
MIRT2108382	hsa-miR-4649-3p	CLIP-seq
MIRT2108384	hsa-miR-4732-3p	CLIP-seq
MIRT2626697	hsa-miR-486-5p	CLIP-seq
MIRT2108385	hsa-miR-544b	CLIP-seq
MIRT2108386	hsa-miR-670	CLIP-seq
MIRT2626694	hsa-miR-2053	CLIP-seq
MIRT2626696	hsa-miR-4642	CLIP-seq
MIRT2626697	hsa-miR-486-5p	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Inorganic anion exchanger activity	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	ISS	17715183
GO:0005886	Component	Plasma membrane	TAS
GO:0008021	Component	Synaptic vesicle	ISS
GO:0008510	Function	Sodium:bicarbonate symporter activity	IBA	21873635
GO:0008510	Function	Sodium:bicarbonate symporter activity	IDA	11133997
GO:0015081	Function	Sodium ion transmembrane transporter activity	IDA	11133997
GO:0015106	Function	Bicarbonate transmembrane transporter activity	IDA	11133997
GO:0015108	Function	Chloride transmembrane transporter activity	IDA	11133997
GO:0015301	Function	Anion:anion antiporter activity	IEA
GO:0015701	Process	Bicarbonate transport	IBA	21873635
GO:0015701	Process	Bicarbonate transport	IDA	11133997
GO:0015701	Process	Bicarbonate transport	TAS
GO:0016020	Component	Membrane	ISS
GO:0016021	Component	Integral component of membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA	21873635
GO:0030425	Component	Dendrite	IDA	17715183
GO:0032279	Component	Asymmetric synapse	ISS
GO:0032280	Component	Symmetric synapse	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0035725	Process	Sodium ion transmembrane transport	IDA	11133997
GO:0042391	Process	Regulation of membrane potential	IDA	11133997, 18577713
GO:0042734	Component	Presynaptic membrane	ISS
GO:0043005	Component	Neuron projection	ISS
GO:0043195	Component	Terminal bouton	ISS
GO:0043679	Component	Axon terminus	ISS
GO:0050801	Process	Ion homeostasis	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	ISS
GO:0051453	Process	Regulation of intracellular pH	IBA	21873635
GO:0051453	Process	Regulation of intracellular pH	IDA	11133997, 18577713
GO:0051453	Process	Regulation of intracellular pH	ISS
GO:0055085	Process	Transmembrane transport	IBA	21873635
GO:0097386	Component	Glial cell projection	ISS
GO:0097457	Component	Hippocampal mossy fiber	ISS
GO:0098793	Component	Presynapse	ISS
GO:0098978	Component	Glutamatergic synapse	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653
GO:1902476	Process	Chloride transmembrane transport	IDA	11133997
GO:2000302	Process	Positive regulation of synaptic vesicle exocytosis	ISS

MIM	HGNC	e!Ensembl
605024	11034	ENSG00000050438

Protein

UniProt ID

Q2Y0W8

Protein name

Electroneutral sodium bicarbonate exchanger 1 (Electroneutral Na(+)-driven Cl-HCO3 exchanger) (Solute carrier family 4 member 8) (k-NBC3)

Protein function

Mediates electroneutral sodium- and carbonate-dependent chloride-HCO3(-) exchange with a Na(+):HCO3(-) stoichiometry of 2:1 (PubMed:18577713). Plays a major role in pH regulation in neurons (By similarity). Mediates sodium reabsorption in the re

PDB

5JHO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07565	Band_3_cyto	145 → 404	Band 3 cytoplasmic domain	Domain
PF00955	HCO3_cotransp	445 → 958	HCO3- transporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the pyramidal cells of the hippocampus (at protein level). Highly expressed in all major regions of the brain, spinal column and in testis, and moderate levels in trachea, thyroid and medulla region of kidney. Low expressi

Sequence

MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQS
HRHHRTHGQKHRRRGRGKGASQGEEGLEALAHDTPSQRVQFILGTEEDEEHVPHELFTEL
DEICMKEGEDAEWKETARWLKFEEDVEDGGERWSKPYVATLSLHSLFELRSCLINGTVLL
DMHANSIEEISDLILDQQELSSDLNDSMRVKVREALLKKHHHQNEKKRNNLIPIVRSFAE
VGKKQSDPHLMDKHGQTVSPQSVPTTNLEVKNGVNCEHSPVDLSKVDLHFMKKIPTGAEA
SNVLVGEVDILDRPIVAFVRLSPAVLLSGLTEVPIPTRFLFILLGPVGKGQQYHEIGRSM
ATIMTDEIFHDVAYKAKERDDLLAGIDEFLDQVTVLPPGEWDPSIRIEPPKNVPSQEKRK
MPGVPNGNVCHIEQEPHGGHSGPELQRTGRLFGGLVLDIKRKAPWYWSDYRDALSLQCLA
SFLFLYCACMSPVITFGGLLGEATEGRISAIESLFGASMTGIAYSLFAGQALTILGSTGP
VLVFEKILFKFCKDYALSYLSLRACIGLWTAFLCIVLVATDASSLVCYITRFTEEAFASL
ICIIFIYEAIEKLIHLAETYPIHMHSQLDHLSLYYCRCTLPENPNNHTLQYWKDHNIVTA
EVHWANLTVSECQEMHGEFMGSACGHHGPYTPDVLFWSCILFFTTFILSSTLKTFKTSRY
FPTRVRSMVSDFAVFLTIFTMVIIDFLIGVPSPKLQVPSVFKPTRDDRGWIINPIGPNPW
WTVIAAIIPALLCTILIFMDQQITAVIINRKEHKLKKGCGYHLDLLMVAIMLGVCSIMGL
PWFVAATVLSITHVNSLKLESECSAPGEQPKFLGIREQRVTGLMIFVLMGCSVFMTAILK
FIPMPVLYGVFLYMGVSSLQGIQFFDRLKLFGMPAKHQPDFIYLRHVPLRKVHLFTLIQL
TCLVLLWVIKASPAAIVFPMMVLALVFVRKVMDLCFSKRELSWLDDLMPESKKKKLDDAK
KKAKEEEEAEKMLEIGGDKFPLESRKLLSSPGKNISCRCDPSEINISDEMPKTTVWKALS
MNSGNAKEKSLFN

Sequence length

1093

Interactions

View interactions

	Reactome
			Bicarbonate transporters

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	23535033

Show/Hide Text Mining Associations (3)

Disease Name	Relationship Type	References
Associations from Text Mining
Leukoencephalopathies	Associate	26451028
Melanoma	Associate	31048755
Papillary Thyroid Microcarcinoma	Associate	34731936

SLC4A8 (solute carrier family 4 member 8)