Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9496
Gene name Gene Name - the full gene name approved by the HGNC.
T-box transcription factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TBX4
Synonyms (NCBI Gene) Gene synonyms aliases
ICPPS, PAPPAS, SPS
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human homolog of mous
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs28936696 A>G Pathogenic Genic downstream transcript variant, missense variant, coding sequence variant
rs28938474 G>T Pathogenic Missense variant, coding sequence variant
rs104894648 C>T Pathogenic Stop gained, coding sequence variant
rs754897911 C>-,CC Likely-pathogenic, uncertain-significance Coding sequence variant, genic downstream transcript variant, frameshift variant
rs886041115 T>G Uncertain-significance, pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025176 hsa-miR-181a-5p Microarray 17612493
MIRT607705 hsa-miR-8485 HITS-CLIP 23313552
MIRT607702 hsa-miR-603 HITS-CLIP 23313552
MIRT607701 hsa-miR-6757-3p HITS-CLIP 23313552
MIRT607700 hsa-miR-6128 HITS-CLIP 23313552
Transcription factors
Transcription factor Regulation Reference
PITX1 Unknown 20598276
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601719 11603 ENSG00000121075
Protein
UniProt ID P57082
Protein name T-box transcription factor TBX4 (T-box protein 4)
Protein function Transcriptional regulator that has an essential role in the organogenesis of lungs, pelvis, and hindlimbs.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00907 T-box 69 251 T-box Domain
Sequence
MLQDKGLSESEEAFRAPGPALGEASAANAPEPALAAPGLSGAALGSPPGPGADVVAAAAA
EQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPSYKVKVTGMNPKTKYILLIDIV
PADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATGAHWMRQLVSFQKLKLTNNHLDP
FGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTHVFPETSFISVTSYQNHKITQLKI
ENNPFAKGFRG
SDDSDLRVARLQSKEYPVISKSIMRQRLISPQLSATPDVGPLLGTHQAL
QHYQHENGAHSQLAEPQDLPLSTFPTQRDSSLFYHCLKRRDGTRHLDLPCKRSYLEAPSS
VGEDHYFRSPPPYDQQMLSPSYCSEVTPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMW
TSVSPYTSYSVQTMETVPYQPFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQS
QVRERGPSASFPRERGLPQGCERKPPSPHLNAANEFLYSQTFSLSRESSLQYHSGMGTVE
NWTDG
Sequence length 545
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Coxopodopatellar Syndrome coxopodopatellar syndrome rs1603251001, rs754897911, rs1555881112, rs28938474, rs1569044884, rs104894648, rs1569036773, rs28936696, rs1603251494, rs1603248606, rs1603256040, rs1603255224, rs1555882291 N/A
Pulmonary arterial hypertension pulmonary arterial hypertension rs1603256095, rs1603248167, rs1397811125, rs1603255267, rs1603255327, rs1603255336, rs1603255339, rs754897911 N/A
Pulmonary Arterial Hypertension Associated With Congenital Heart Disease pulmonary arterial hypertension associated with congenital heart disease rs1555883338, rs754897911, rs1555883342, rs1555882009, rs1555882291 N/A
Pulmonary Hypertension pulmonary hypertension, primary, 1 rs754897911, rs1603256095, rs1603248167, rs1555883342, rs1603248606, rs1603255327, rs1603255224 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypertension Hypertension (confirmatory factor analysis Factor 12) N/A N/A GWAS
Pulmonary Hypoplasia primary pulmonary hypoplasia N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32688456
Al Awadi syndrome Associate 31761294
Alveolar capillary dysplasia Associate 37821225, 40008593
Apraxias Associate 29070031
Ataxia Telangiectasia Associate 35852389
Blindness Associate 31761294
Bowen syndrome Associate 31965066
Breast Neoplasms Associate 19454617
Bronchiolitis Obliterans Associate 35075769
Carcinoma Acinar Cell Associate 30828993