KIF23 (kinesin family member 23)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 9493
Gene name Kinesin family member 23
Gene symbol KIF23
Synonyms (NCBI Gene)
CDA3CDAIIICDAN3CDAN3ACHO1KNSL5MKLP-1MKLP1
Chromosome 15
Chromosome location 15q23
Summary The protein encoded by this gene is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross
SNPs SNP information provided by dbSNP.
1
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
SNP ID Visualize variation Clinical significance Consequence
rs748016594 T>A,C Likely-pathogenic Non coding transcript variant, coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
601
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (601)
miRTarBase ID miRNA Experiments Reference
MIRT000657 hsa-miR-424-5p Luciferase reporter assay 19956200
MIRT002495 hsa-miR-373-3p Microarray 15685193
MIRT002495 hsa-miR-373-3p Microarray;Other 15685193
MIRT020426 hsa-miR-106b-5p Microarray 17242205
MIRT024496 hsa-miR-215-5p Microarray 19074876
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (42)
GO ID Ontology Definition Evidence Reference
GO:0000022 Process Mitotic spindle elongation TAS 1406973
GO:0000166 Function Nucleotide binding IEA
GO:0000281 Process Mitotic cytokinesis IMP 15843429, 16236794
GO:0003777 Function Microtubule motor activity IBA
GO:0003777 Function Microtubule motor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605064 6392 ENSG00000137807
Protein Protein information from UniProt database.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q02241
Protein name Kinesin-like protein KIF23 (Kinesin-like protein 5) (Mitotic kinesin-like protein 1)
Protein function Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Essential for cytokinesis in Rho-mediated signaling.
PDB 3VHX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00225 Kinesin 31 → 436 Kinesin motor domain Domain
PF16540 MKLP1_Arf_bdg 803 → 906 Arf6-interacting domain of mitotic kinesin-like protein 1 Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:23570799}.
Sequence 
MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGY
RLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTH
TMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMP
NPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
PIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
SHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNI
NQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY
EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPL
PSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHM
QGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKL
QRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTE
PKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSI
SVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTF
RNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH
AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQ
ESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
Sequence length 960
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Motor proteins
MicroRNAs in cancer 		  MHC class II antigen presentation
COPI-dependent Golgi-to-ER retrograde traffic
Mitotic Telophase/Cytokinesis
Kinesins
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
59
Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (2)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Congenital dyserythropoietic anemia, type III Likely pathogenic; Pathogenic rs2140422904, rs2140424959 RCV001848617
RCV001848618
Microcephaly Likely pathogenic rs748016594 RCV000454155
Show/Hide Unknown Diseases (12)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Uncertain significance rs62007332 RCV005930113
Colon adenocarcinoma Benign; Likely benign rs61751120 RCV005908176
Familial cancer of breast Likely benign; Benign rs76148443, rs61751120, rs769489533 RCV005926470
RCV005908175
RCV005903129
Gastric cancer Likely benign rs769489533 RCV005903131
Show/Hide Text Mining Associations (36)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33148251
Anemia Dyserythropoietic Congenital Associate 23570799
Breast Neoplasms Associate 24391143, 30593585, 31758680, 34675265
Carcinogenesis Associate 35524313
Carcinoma Hepatocellular Stimulate 26674738
Carcinoma Hepatocellular Associate 34324544, 34983303, 40255404
Carcinoma Non Small Cell Lung Associate 21412013
Carcinoma Ovarian Epithelial Associate 33726773
Carcinoma Pancreatic Ductal Associate 29483831
Carcinoma Renal Cell Associate 28260099, 32481352