Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9479
Gene name Gene Name - the full gene name approved by the HGNC.	Mitogen-activated protein kinase 8 interacting protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MAPK8IP1
Synonyms (NCBI Gene) Gene synonyms aliases	IB1, JIP-1, JIP1, PRKM8IP
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p11.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a regulator of the pancreatic beta-cell function. It is highly similar to JIP-1, a mouse protein known to be a regulator of c-Jun amino-terminal kinase (Mapk8). This protein has been shown to prevent MAPK8 mediated activation of transcri

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs119489103	G>A	Pathogenic	Coding sequence variant, missense variant

Show/Hide all(53)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004239	hsa-miR-346	Microarray	16822819
MIRT042394	hsa-miR-191-3p	CLASH	23622248
MIRT440276	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT440276	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT1131146	hsa-miR-1233	CLIP-seq
MIRT1131147	hsa-miR-3714	CLIP-seq
MIRT1131148	hsa-miR-4722-5p	CLIP-seq
MIRT1131149	hsa-miR-615-3p	CLIP-seq
MIRT1131150	hsa-miR-940	CLIP-seq
MIRT1551129	hsa-miR-3141	CLIP-seq
MIRT2037382	hsa-miR-1245b-5p	CLIP-seq
MIRT2037383	hsa-miR-214	CLIP-seq
MIRT2037384	hsa-miR-3142	CLIP-seq
MIRT2037385	hsa-miR-3619-5p	CLIP-seq
MIRT2037386	hsa-miR-3918	CLIP-seq
MIRT2037387	hsa-miR-4291	CLIP-seq
MIRT2037388	hsa-miR-4512	CLIP-seq
MIRT2037389	hsa-miR-761	CLIP-seq
MIRT2037390	hsa-miR-922	CLIP-seq
MIRT2267270	hsa-miR-1207-5p	CLIP-seq
MIRT2267271	hsa-miR-1237	CLIP-seq
MIRT2267272	hsa-miR-1248	CLIP-seq
MIRT2267273	hsa-miR-338-3p	CLIP-seq
MIRT2267274	hsa-miR-3690	CLIP-seq
MIRT2037386	hsa-miR-3918	CLIP-seq
MIRT2267275	hsa-miR-4254	CLIP-seq
MIRT2267276	hsa-miR-4268	CLIP-seq
MIRT2267277	hsa-miR-4448	CLIP-seq
MIRT2267278	hsa-miR-4727-5p	CLIP-seq
MIRT2267279	hsa-miR-4736	CLIP-seq
MIRT2267280	hsa-miR-4763-3p	CLIP-seq
MIRT2267281	hsa-miR-4769-3p	CLIP-seq
MIRT2267282	hsa-miR-486-3p	CLIP-seq
MIRT2267283	hsa-miR-769-5p	CLIP-seq
MIRT2267284	hsa-miR-942	CLIP-seq
MIRT2267270	hsa-miR-1207-5p	CLIP-seq
MIRT1131146	hsa-miR-1233	CLIP-seq
MIRT2267279	hsa-miR-4736	CLIP-seq
MIRT2267280	hsa-miR-4763-3p	CLIP-seq
MIRT1131149	hsa-miR-615-3p	CLIP-seq
MIRT2267270	hsa-miR-1207-5p	CLIP-seq
MIRT1131146	hsa-miR-1233	CLIP-seq
MIRT2684585	hsa-miR-1294	CLIP-seq
MIRT2684586	hsa-miR-1909	CLIP-seq
MIRT2684587	hsa-miR-1972	CLIP-seq
MIRT2684588	hsa-miR-3064-3p	CLIP-seq
MIRT2267273	hsa-miR-338-3p	CLIP-seq
MIRT2684589	hsa-miR-4697-3p	CLIP-seq
MIRT2684590	hsa-miR-4710	CLIP-seq
MIRT1131148	hsa-miR-4722-5p	CLIP-seq
MIRT2267279	hsa-miR-4736	CLIP-seq
MIRT2267280	hsa-miR-4763-3p	CLIP-seq
MIRT1131149	hsa-miR-615-3p	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004860	Function	Protein kinase inhibitor activity	TAS	9933567
GO:0005078	Function	MAP-kinase scaffold activity	IBA
GO:0005078	Function	MAP-kinase scaffold activity	IEA
GO:0005078	Function	MAP-kinase scaffold activity	IPI	11238452
GO:0005515	Function	Protein binding	IPI	11517249, 11724784, 11726277, 16273093, 16840345, 17709393, 18286207, 31413325, 31980649, 33961781, 35914814
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10574993
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007254	Process	JNK cascade	IBA
GO:0008432	Function	JUN kinase binding	IBA
GO:0008432	Function	JUN kinase binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016192	Process	Vesicle-mediated transport	ISS
GO:0019894	Function	Kinesin binding	IEA
GO:0019894	Function	Kinesin binding	IPI	11238452
GO:0019901	Function	Protein kinase binding	IEA
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IEA
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043508	Process	Negative regulation of JUN kinase activity	ISS
GO:0044294	Component	Dendritic growth cone	IEA
GO:0044295	Component	Axonal growth cone	IEA
GO:0044302	Component	Dentate gyrus mossy fiber	IEA
GO:0045202	Component	Synapse	IEA
GO:0046328	Process	Regulation of JNK cascade	IEA
GO:0046328	Process	Regulation of JNK cascade	ISS
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:2000564	Process	Regulation of CD8-positive, alpha-beta T cell proliferation	IEA
GO:2000564	Process	Regulation of CD8-positive, alpha-beta T cell proliferation	ISS
GO:2001243	Process	Negative regulation of intrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
604641	6882	ENSG00000121653

Protein

UniProt ID

Q9UQF2

Protein name

C-Jun-amino-terminal kinase-interacting protein 1 (JIP-1) (JNK-interacting protein 1) (Islet-brain 1) (IB-1) (JNK MAP kinase scaffold protein 1) (Mitogen-activated protein kinase 8-interacting protein 1)

Protein function

The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. Required for JNK activation in response to excitoto

PDB

2G01 , 2GMX , 2H96 , 3OXI , 3PTG , 3VUD , 3VUG , 3VUH , 3VUI , 3VUK , 3VUL , 3VUM , 4E73 , 4G1W , 4H39 , 4HYS , 4HYU , 4IZY , 5LW1 , 6FUZ , 7NYK , 7NYL , 7NYM , 7NYN , 7NYO , 7NZB , 8RPP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14604	SH3_9	495 → 544	Variant SH3 domain	Domain
PF00640	PID	567 → 701	Phosphotyrosine interaction domain (PTB/PID)	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain. Expressed in neurons, localizing to neurite tips in differentiating cells. Also expressed in the pancreas, testis and prostate. Low levels in heart, ovary and small intestine. Decreased levels in pancreatic b

Sequence

MAERESGGLGGGAASPPAASPFLGLHIASPPNFRLTHDISLEEFEDEDLSEITDECGISL
QCKDTLSLRPPRAGLLSAGGGGAGSRLQAEMLQMDLIDATGDTPGAEDDEEDDDEERAAR
RPGAGPPKAESGQEPASRGQGQSQGQSQGPGSGDTYRPKRPTTLNLFPQVPRSQDTLNNN
SLGKKHSWQDRVSRSSSPLKTGEQTPPHEHICLSDELPPQSGPAPTTDRGTSTDSPCRRS
TATQMAPPGGPPAAPPGGRGHSHRDRIHYQADVRLEATEEIYLTPVQRPPDAAEPTSAFL
PPTESRMSVSSDPDPAAYPSTAGRPHPSISEEEEGFDCLSSPERAEPPGGGWRGSLGEPP
PPPRASLSSDTSALSYDSVKYTLVVDEHAQLELVSLRPCFGDYSDESDSATVYDNCASVS
SPYESAIGEEYEEAPRPQPPACLSEDSTPDEPDVHFSKKFLNVFMSGRSRSSSAESFGLF
SCIINGEEQEQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEAYNMRTGARGVFP
AYYAIEVTKEPEHMAALAKNSDWVDQFRVKFLGSVQVPYHKGNDVLCAAMQKIATTRRLT
VHFNPPSSCVLEISVRGVKIGVKADDSQEAKGNKCSHFFQLKNISFCGYHPKNNKYFGFI
TKHPADHRFACHVFVSEDSTKALAESVGRAFQQFYKQFVEYTCPTEDIYLE

Sequence length

711

Interactions

View interactions

	KEGG
	MAPK signaling pathway

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Bipolar Disorder	Bipolar I disorder	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Diabetes Mellitus	Diabetes mellitus type 2, susceptibility to, diabetes mellitus, noninsulin-dependent	N/A	N/A	ClinVar, GenCC

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Alzheimer Disease	Associate	11724784
Bipolar Disorder	Associate	25989161
Cluster Headache	Associate	34256648
Diabetes Mellitus Type 2	Associate	34391409
Neoplasms	Associate	23045411
Neoplasms Germ Cell and Embryonal	Associate	15868948
Obesity	Associate	33924512, 34391409
Osteosarcoma	Inhibit	30013340
Parkinson Disease	Associate	19146923
Potocki Shaffer syndrome	Associate	33836758
Prostatic Neoplasms	Associate	15138488

MAPK8IP1 (mitogen-activated protein kinase 8 interacting protein 1)