Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9475
Gene name Gene Name - the full gene name approved by the HGNC.	Rho associated coiled-coil containing protein kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ROCK2
Synonyms (NCBI Gene) Gene synonyms aliases	ROCK-II
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2p25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is a

Show/Hide all(423)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000494	hsa-miR-138-5p	qRT-PCR, Luciferase reporter assay, Western blot	20232393
MIRT006478	hsa-miR-124-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21672940
MIRT006478	hsa-miR-124-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21672940
MIRT000494	hsa-miR-138-5p	Reporter assay;Other	20232393
MIRT006478	hsa-miR-124-3p	Reporter assay;qRT-PCR	21672940
MIRT052902	hsa-miR-142-3p	Luciferase reporter assay, qRT-PCR, Western blot	24743945
MIRT054808	hsa-miR-139-5p	Luciferase reporter assay, Western blot, qRT-PCR	24942287
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	24169343
MIRT438203	hsa-miR-200c-3p	Luciferase reporter assay	24169343
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	24169343
MIRT438203	hsa-miR-200c-3p	Luciferase reporter assay	24169343
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707468	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707467	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT707466	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT707465	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT707464	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707463	hsa-miR-4455	HITS-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT542162	hsa-miR-5695	HITS-CLIP	23824327
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542164	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT542163	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT542162	hsa-miR-5695	PAR-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542160	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT542159	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT052902	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT052902	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707468	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707467	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT707466	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT707465	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT707464	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707463	hsa-miR-4455	HITS-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT542162	hsa-miR-5695	HITS-CLIP	23824327
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542164	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT542163	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT542162	hsa-miR-5695	PAR-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542160	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT542159	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT755497	hsa-miR-30a-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	37899171
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT1314707	hsa-miR-1299	CLIP-seq
MIRT1314708	hsa-miR-1324	CLIP-seq
MIRT1314709	hsa-miR-135a	CLIP-seq
MIRT1314710	hsa-miR-135b	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314715	hsa-miR-200b	CLIP-seq
MIRT1314716	hsa-miR-200c	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT1314718	hsa-miR-31	CLIP-seq
MIRT1314719	hsa-miR-3119	CLIP-seq
MIRT1314720	hsa-miR-3126-3p	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT1314722	hsa-miR-3145-5p	CLIP-seq
MIRT1314723	hsa-miR-3148	CLIP-seq
MIRT1314724	hsa-miR-3149	CLIP-seq
MIRT1314725	hsa-miR-3163	CLIP-seq
MIRT1314726	hsa-miR-3192	CLIP-seq
MIRT1314727	hsa-miR-3529	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT1314730	hsa-miR-3662	CLIP-seq
MIRT1314731	hsa-miR-3672	CLIP-seq
MIRT1314732	hsa-miR-3674	CLIP-seq
MIRT1314733	hsa-miR-3681	CLIP-seq
MIRT1314734	hsa-miR-3688-3p	CLIP-seq
MIRT1314735	hsa-miR-374c	CLIP-seq
MIRT1314736	hsa-miR-379	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314739	hsa-miR-429	CLIP-seq
MIRT1314740	hsa-miR-4314	CLIP-seq
MIRT1314741	hsa-miR-4329	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314744	hsa-miR-4422	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314747	hsa-miR-4446-3p	CLIP-seq
MIRT1314748	hsa-miR-4451	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT1314750	hsa-miR-448	CLIP-seq
MIRT1314751	hsa-miR-450b-3p	CLIP-seq
MIRT1314752	hsa-miR-4646-5p	CLIP-seq
MIRT1314753	hsa-miR-4650-3p	CLIP-seq
MIRT1314754	hsa-miR-4656	CLIP-seq
MIRT1314755	hsa-miR-4676-5p	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT1314757	hsa-miR-4713-3p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT1314765	hsa-miR-545	CLIP-seq
MIRT1314766	hsa-miR-548al	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT1314768	hsa-miR-568	CLIP-seq
MIRT1314769	hsa-miR-575	CLIP-seq
MIRT1314770	hsa-miR-580	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT1314772	hsa-miR-603	CLIP-seq
MIRT1314773	hsa-miR-638	CLIP-seq
MIRT1314774	hsa-miR-655	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT1314777	hsa-miR-769-3p	CLIP-seq
MIRT1314778	hsa-miR-875-3p	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT2093606	hsa-miR-1254	CLIP-seq
MIRT2093607	hsa-miR-1266	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314715	hsa-miR-200b	CLIP-seq
MIRT1314716	hsa-miR-200c	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT2093610	hsa-miR-297	CLIP-seq
MIRT2093611	hsa-miR-3064-3p	CLIP-seq
MIRT2093612	hsa-miR-3116	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT2093614	hsa-miR-3659	CLIP-seq
MIRT2093615	hsa-miR-3664-3p	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2093617	hsa-miR-3924	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314739	hsa-miR-429	CLIP-seq
MIRT2093618	hsa-miR-4420	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT2093619	hsa-miR-4435	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT2093620	hsa-miR-4518	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2093622	hsa-miR-4658	CLIP-seq
MIRT2093623	hsa-miR-4717-5p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT2093624	hsa-miR-4789-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT2093626	hsa-miR-5096	CLIP-seq
MIRT2093627	hsa-miR-513a-3p	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT2093628	hsa-miR-567	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT2093629	hsa-miR-622	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT2093631	hsa-miR-661	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093632	hsa-miR-873	CLIP-seq
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT2318122	hsa-miR-1207-3p	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT2093607	hsa-miR-1266	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT2318123	hsa-miR-300	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT2318124	hsa-miR-3200-5p	CLIP-seq
MIRT2318125	hsa-miR-3591-3p	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT2093615	hsa-miR-3664-3p	CLIP-seq
MIRT1314732	hsa-miR-3674	CLIP-seq
MIRT2318126	hsa-miR-3689a-5p	CLIP-seq
MIRT2318127	hsa-miR-3689b	CLIP-seq
MIRT2318128	hsa-miR-3689e	CLIP-seq
MIRT2318129	hsa-miR-3689f	CLIP-seq
MIRT2318130	hsa-miR-381	CLIP-seq
MIRT2318131	hsa-miR-3920	CLIP-seq
MIRT2318132	hsa-miR-3977	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT2093618	hsa-miR-4420	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT1314750	hsa-miR-448	CLIP-seq
MIRT2093620	hsa-miR-4518	CLIP-seq
MIRT2318133	hsa-miR-4529-5p	CLIP-seq
MIRT2318134	hsa-miR-4640-5p	CLIP-seq
MIRT2318135	hsa-miR-4666-3p	CLIP-seq
MIRT2318136	hsa-miR-4672	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT2318137	hsa-miR-4714-3p	CLIP-seq
MIRT2093623	hsa-miR-4717-5p	CLIP-seq
MIRT2318138	hsa-miR-4720-3p	CLIP-seq
MIRT2318139	hsa-miR-4726-5p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT2318140	hsa-miR-4765	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT2318141	hsa-miR-4804-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT2093626	hsa-miR-5096	CLIP-seq
MIRT2318142	hsa-miR-519a	CLIP-seq
MIRT2318143	hsa-miR-519b-3p	CLIP-seq
MIRT2318144	hsa-miR-519c-3p	CLIP-seq
MIRT2318145	hsa-miR-548ac	CLIP-seq
MIRT2318146	hsa-miR-548d-3p	CLIP-seq
MIRT2318147	hsa-miR-548z	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT2093629	hsa-miR-622	CLIP-seq
MIRT2318148	hsa-miR-649	CLIP-seq
MIRT2318149	hsa-miR-656	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093632	hsa-miR-873	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2318124	hsa-miR-3200-5p	CLIP-seq
MIRT2393860	hsa-miR-3614-3p	CLIP-seq
MIRT2318131	hsa-miR-3920	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT2318136	hsa-miR-4672	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT2393861	hsa-miR-4764-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT2318142	hsa-miR-519a	CLIP-seq
MIRT2318143	hsa-miR-519b-3p	CLIP-seq
MIRT2318144	hsa-miR-519c-3p	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT2393862	hsa-miR-618	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT2458503	hsa-miR-106a	CLIP-seq
MIRT2458504	hsa-miR-106b	CLIP-seq
MIRT2458505	hsa-miR-142-5p	CLIP-seq
MIRT2458506	hsa-miR-17	CLIP-seq
MIRT2458507	hsa-miR-20a	CLIP-seq
MIRT2458508	hsa-miR-20b	CLIP-seq
MIRT1314725	hsa-miR-3163	CLIP-seq
MIRT2458509	hsa-miR-3609	CLIP-seq
MIRT2458510	hsa-miR-4747-5p	CLIP-seq
MIRT2458511	hsa-miR-4796-3p	CLIP-seq
MIRT2458512	hsa-miR-519d	CLIP-seq
MIRT2458513	hsa-miR-548ah	CLIP-seq
MIRT1314768	hsa-miR-568	CLIP-seq
MIRT2458514	hsa-miR-93	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT2613891	hsa-miR-124	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2613892	hsa-miR-130a	CLIP-seq
MIRT2613893	hsa-miR-130b	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2613894	hsa-miR-2277-3p	CLIP-seq
MIRT2613895	hsa-miR-301a	CLIP-seq
MIRT2613896	hsa-miR-301b	CLIP-seq
MIRT2093611	hsa-miR-3064-3p	CLIP-seq
MIRT2318125	hsa-miR-3591-3p	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT2613897	hsa-miR-3666	CLIP-seq
MIRT1314731	hsa-miR-3672	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2613898	hsa-miR-3714	CLIP-seq
MIRT2613899	hsa-miR-3910	CLIP-seq
MIRT2613900	hsa-miR-3913-3p	CLIP-seq
MIRT2613901	hsa-miR-4295	CLIP-seq
MIRT2613902	hsa-miR-4310	CLIP-seq
MIRT2613903	hsa-miR-4423-5p	CLIP-seq
MIRT2613904	hsa-miR-4506	CLIP-seq
MIRT2613905	hsa-miR-454	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2613906	hsa-miR-4671-3p	CLIP-seq
MIRT2613907	hsa-miR-4698	CLIP-seq
MIRT2613908	hsa-miR-4774-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT2613909	hsa-miR-506	CLIP-seq
MIRT2613910	hsa-miR-548c-3p	CLIP-seq
MIRT2613911	hsa-miR-555	CLIP-seq
MIRT2613912	hsa-miR-561	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq
MIRT2318149	hsa-miR-656	CLIP-seq
MIRT2613913	hsa-miR-885-5p	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT2613910	hsa-miR-548c-3p	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq

Show/Hide all(112)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0002020	Function	Protease binding	IPI	24305806
GO:0002931	Process	Response to ischemia	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16574662, 21147781
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	24305806, 29353861
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	24305806
GO:0005198	Function	Structural molecule activity	NAS	9933571
GO:0005515	Function	Protein binding	IPI	17015463, 20230755, 24305806, 30413785, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	39106863
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	17015463
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	18559669
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	39106863
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IMP	24065547
GO:0008270	Function	Zinc ion binding	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010825	Process	Positive regulation of centrosome duplication	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0016740	Function	Transferase activity	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030335	Process	Positive regulation of cell migration	IMP	20232393
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031644	Process	Regulation of nervous system process	ISS
GO:0032723	Process	Positive regulation of connective tissue growth factor production	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043149	Process	Stress fiber assembly	IDA	39106863
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044788	Process	Host-mediated perturbation of viral process	IMP	19376974
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IMP	29353861
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0045937	Process	Positive regulation of phosphate metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048511	Process	Rhythmic process	IEA
GO:0048598	Process	Embryonic morphogenesis	IBA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0051298	Process	Centrosome duplication	IMP	17015463
GO:0051492	Process	Regulation of stress fiber assembly	IEA
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	39106863
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	20232393
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0061133	Function	Endopeptidase activator activity	IMP	24305806
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IEA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IMP	24065547
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	TAS	28679962
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090271	Process	Positive regulation of fibroblast growth factor production	ISS
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	ISS
GO:0150033	Process	Negative regulation of protein localization to lysosome	IMP	24305806
GO:1900037	Process	Regulation of cellular response to hypoxia	ISS
GO:1901888	Process	Regulation of cell junction assembly	IBA
GO:1902003	Process	Regulation of amyloid-beta formation	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	IMP	24305806
GO:1902966	Process	Positive regulation of protein localization to early endosome	IMP	24305806
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IMP	24305806
GO:1903140	Process	Regulation of establishment of endothelial barrier	IEA
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IEA
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905145	Process	Cellular response to acetylcholine	ISS
GO:1905205	Process	Positive regulation of connective tissue replacement	ISS
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124

MIM	HGNC	e!Ensembl
604002	10252	ENSG00000134318

Protein

UniProt ID

O75116

Protein name

Rho-associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho-associated, coiled-coil-containing protein kinase 2) (Rho-associated, coiled-coil-containing protein kinase II) (ROCK-II) (p164 ROCK-2)

Protein function

Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion a

PDB

4L6Q , 4WOT , 5U7Q , 5U7R , 6ED6 , 6P5M , 6P5P , 7JNT , 7JOV , 7P6N , 8GDS , 8X8X , 8X8Y , 8X8Z , 8X92 , 9EP8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	92 → 354	Protein kinase domain	Domain
PF08912	Rho_Binding	978 → 1046	Rho Binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain (at protein level). {ECO:0000269|PubMed:21147781}.

Sequence

MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS

Sequence length

1388

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway cAMP signaling pathway Chemokine signaling pathway Sphingolipid signaling pathway Vascular smooth muscle contraction Wnt signaling pathway Axon guidance Focal adhesion Adherens junction Tight junction Platelet activation Leukocyte transendothelial migration Regulation of actin cytoskeleton Oxytocin signaling pathway Pathogenic Escherichia coli infection Shigellosis Salmonella infection Yersinia infection Human cytomegalovirus infection Pathways in cancer Proteoglycans in cancer Lipid and atherosclerosis		EPHB-mediated forward signaling G alpha (12/13) signalling events Sema4D induced cell migration and growth-cone collapse VEGFA-VEGFR2 Pathway RHO GTPases Activate ROCKs

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Dextrocardia	dextrocardia	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (64)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26901778
Adenocarcinoma of Lung	Associate	36453714
Adenomyosis	Associate	30387365
Alzheimer Disease	Associate	36499116
Arthritis Rheumatoid	Associate	25385601
Atherosclerosis	Associate	30884801
Autoimmune Diseases	Associate	25385601
Breast Neoplasms	Associate	26626121, 29990315, 35100495
Carcinogenesis	Associate	22942252, 26261605
Carcinoma Hepatocellular	Associate	25969175, 26846339, 30779947, 31117934, 32546442, 32647287
Carcinoma Non Small Cell Lung	Associate	22942252, 27229528
Carcinoma Renal Cell	Inhibit	28052041
Carcinoma Squamous Cell	Stimulate	35593591
Cardiovascular Diseases	Associate	23326532
Cerebral Infarction	Associate	29246448
Cholesteatoma	Associate	35177391
Colorectal Neoplasms	Associate	17876296, 24942287
Conversion Disorder	Associate	34371182
Diabetes Mellitus	Associate	29955616
Drug Related Side Effects and Adverse Reactions	Associate	24642531
Endometrial Neoplasms	Associate	30387365
Endometriosis	Associate	22225925
Esophageal Squamous Cell Carcinoma	Associate	26261605
Essential Hypertension	Associate	26818475
Fibrosis	Associate	24674677
Gastroesophageal Reflux	Stimulate	26901778
Glioma	Associate	24642531, 35145081, 37873881
Heart Defects Congenital	Associate	28336264, 31941532
Hemorrhagic Stroke	Associate	29246448
Hypertension	Inhibit	18971541
Hypertension	Associate	18971541
Hypoxia	Associate	30475758
Idiopathic Pulmonary Fibrosis	Associate	24674677
Inflammation	Associate	29766980, 30884801, 31117934, 32252692, 33576448, 35848968
Insulin Resistance	Associate	32100372
Kidney Neoplasms	Associate	34974812
Leukemia Lymphocytic Chronic B Cell	Associate	23044996
Lupus Erythematosus Systemic	Associate	31137925
Lymphatic Metastasis	Associate	25755711
Lymphoma Large B Cell Diffuse	Associate	32753663
Lymphoma Mantle Cell	Associate	26377148
Menorrhagia	Associate	30387365
Mental Disorders	Associate	23211630
Mesothelioma	Associate	28470935
Metabolic Syndrome	Associate	26004609
Mitral Valve Insufficiency	Stimulate	25956928
Myotonic Dystrophy	Associate	36767649
Neoplasm Metastasis	Associate	17876296, 26261605, 26626121, 30864107, 37164685
Neoplasms	Associate	17876296, 22942252, 23044996, 23319410, 25755711, 26261605, 28650698, 29990315, 30475758, 31488179, 32647287, 35365653
Neoplasms	Stimulate	27203208
Neoplasms Glandular and Epithelial	Associate	38297223
Neoplasms Squamous Cell	Associate	34642392
Obesity	Associate	32100372
Pancreatic Neoplasms	Associate	22232555, 35322742, 37164685
Parkinson Disease	Associate	26748453
Pulmonary Arterial Hypertension	Associate	37753829
Pulmonary edema of mountaineers	Associate	26818475
Respiratory Distress Syndrome	Associate	27269648
Sarcoma Ewing	Associate	28112365
Sepsis	Associate	38297223
Sleep Apnea Obstructive	Associate	29475915
Squamous Cell Carcinoma of Head and Neck	Associate	20232393, 25755711
Urinary Bladder Neoplasms	Associate	30475758
Uterine Cervical Neoplasms	Associate	20429915, 31488179

ROCK2 (Rho associated coiled-coil containing protein kinase 2)