Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9470
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation initiation factor 4E family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EIF4E2
Synonyms (NCBI Gene) Gene synonyms aliases	4E-LP, 4EHP, EIF4EL3, IF4e, h4EHP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020573	hsa-miR-155-5p	Proteomics	18668040
MIRT027566	hsa-miR-98-5p	Microarray	19088304
MIRT047290	hsa-miR-181b-5p	CLASH	23622248
MIRT727790	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727789	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT958106	hsa-miR-1207-3p	CLIP-seq
MIRT958107	hsa-miR-1236	CLIP-seq
MIRT958108	hsa-miR-1245	CLIP-seq
MIRT958109	hsa-miR-29a	CLIP-seq
MIRT958110	hsa-miR-29b	CLIP-seq
MIRT958111	hsa-miR-29c	CLIP-seq
MIRT958112	hsa-miR-3163	CLIP-seq
MIRT958113	hsa-miR-3662	CLIP-seq
MIRT958114	hsa-miR-4477a	CLIP-seq
MIRT958115	hsa-miR-4695-3p	CLIP-seq
MIRT958116	hsa-miR-4729	CLIP-seq
MIRT958117	hsa-miR-767-5p	CLIP-seq
MIRT2522323	hsa-miR-4419a	CLIP-seq
MIRT2522324	hsa-miR-4510	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq

Show/Hide all(28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000339	Function	RNA cap binding	TAS	9582349
GO:0000340	Function	RNA 7-methylguanosine cap binding	IBA
GO:0000340	Function	RNA 7-methylguanosine cap binding	IDA	35878012
GO:0000932	Component	P-body	IDA	23991149
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003743	Function	Translation initiation factor activity	IBA
GO:0003743	Function	Translation initiation factor activity	IEA
GO:0005515	Function	Protein binding	IPI	15094042, 15161933, 16189514, 17368478, 19060904, 22678294, 23991149, 25416956, 25959826, 28487484, 28514442, 28698298, 31439631, 31515488, 32814053, 33053355, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	23991149
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IBA
GO:0006413	Process	Translational initiation	IEA
GO:0006417	Process	Regulation of translation	IEA
GO:0008135	Function	Translation factor activity, RNA binding	TAS	9582349
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IBA
GO:0017148	Process	Negative regulation of translation	IMP	22751931
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14623119
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	28487484
GO:0045947	Process	Negative regulation of translational initiation	IDA	32726578, 35878012
GO:0060337	Process	Type I interferon-mediated signaling pathway	IDA	33581076
GO:0060339	Process	Negative regulation of type I interferon-mediated signaling pathway	IDA	35878012
GO:0072344	Process	Rescue of stalled ribosome	IDA	32726578
GO:0098808	Function	MRNA cap binding	IDA	17368478

MIM	HGNC	e!Ensembl
605895	3293	ENSG00000135930

Protein

UniProt ID

O60573

Protein name

Eukaryotic translation initiation factor 4E type 2 (eIF-4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP) (mRNA cap-binding protein 4E

Protein function

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation (PubMed:17368478, PubMed:22751931, PubMed:25624349, PubMed:33581076, PubMed:9582349). In contras

PDB

2JGB , 2JGC , 5NVK , 5NVL , 5NVM , 5NVN , 5XLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01652	IF4E	55 → 214	Eukaryotic initiation factor 4E	Domain

Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP

Sequence length

245

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance HIF-1 signaling pathway mTOR signaling pathway PI3K-Akt signaling pathway Longevity regulating pathway Insulin signaling pathway		ISG15 antiviral mechanism

EIF4E2 (eukaryotic translation initiation factor 4E family member 2)