Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9470
Gene name Gene Name - the full gene name approved by the HGNC.	Eukaryotic translation initiation factor 4E family member 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	EIF4E2
Synonyms (NCBI Gene) Gene synonyms aliases	4E-LP, 4EHP, EIF4EL3, IF4e, h4EHP
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q37.1

Show/Hide all(23)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020573	hsa-miR-155-5p	Proteomics	18668040
MIRT027566	hsa-miR-98-5p	Microarray	19088304
MIRT047290	hsa-miR-181b-5p	CLASH	23622248
MIRT727790	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT727789	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT958106	hsa-miR-1207-3p	CLIP-seq
MIRT958107	hsa-miR-1236	CLIP-seq
MIRT958108	hsa-miR-1245	CLIP-seq
MIRT958109	hsa-miR-29a	CLIP-seq
MIRT958110	hsa-miR-29b	CLIP-seq
MIRT958111	hsa-miR-29c	CLIP-seq
MIRT958112	hsa-miR-3163	CLIP-seq
MIRT958113	hsa-miR-3662	CLIP-seq
MIRT958114	hsa-miR-4477a	CLIP-seq
MIRT958115	hsa-miR-4695-3p	CLIP-seq
MIRT958116	hsa-miR-4729	CLIP-seq
MIRT958117	hsa-miR-767-5p	CLIP-seq
MIRT2522323	hsa-miR-4419a	CLIP-seq
MIRT2522324	hsa-miR-4510	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq
MIRT2522325	hsa-miR-520a-5p	CLIP-seq
MIRT2522326	hsa-miR-525-5p	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000339	Function	RNA cap binding	TAS	9582349
GO:0000340	Function	RNA 7-methylguanosine cap binding	IBA	21873635
GO:0000932	Component	P-body	IDA	23991149
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003743	Function	Translation initiation factor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 17368478, 19060904, 22678294, 23991149, 25416956, 25959826, 28487484, 28514442, 31515488, 32814053
GO:0005737	Component	Cytoplasm	IDA	23991149
GO:0005829	Component	Cytosol	TAS
GO:0005845	Component	MRNA cap binding complex	IDA	17368478
GO:0006413	Process	Translational initiation	IEA
GO:0008135	Function	Translation factor activity, RNA binding	TAS	9582349
GO:0016281	Component	Eukaryotic translation initiation factor 4F complex	IBA	21873635
GO:0017148	Process	Negative regulation of translation	IMP	22751931
GO:0031047	Process	Gene silencing by RNA	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	14623119
GO:1905618	Process	Positive regulation of miRNA mediated inhibition of translation	IDA	28487484

MIM	HGNC	e!Ensembl
605895	3293	ENSG00000135930

Protein

UniProt ID

O60573

Protein name

Eukaryotic translation initiation factor 4E type 2 (eIF-4E type 2) (eIF4E type 2) (Eukaryotic translation initiation factor 4E homologous protein) (Eukaryotic translation initiation factor 4E-like 3) (eIF4E-like protein 4E-LP) (mRNA cap-binding protein 4E

Protein function

Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation (PubMed:17368478, PubMed:22751931, PubMed:25624349, PubMed:33581076, PubMed:9582349). In contras

PDB

2JGB , 2JGC , 5NVK , 5NVL , 5NVM , 5NVN , 5XLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01652	IF4E	55 → 214	Eukaryotic initiation factor 4E	Domain

Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKP
RLNVP

Sequence length

245

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance HIF-1 signaling pathway mTOR signaling pathway PI3K-Akt signaling pathway Longevity regulating pathway Insulin signaling pathway		ISG15 antiviral mechanism

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	21079520

Show/Hide Text Mining Associations (12)

Disease Name	Relationship Type	References
Associations from Text Mining
Carcinoma Non Small Cell Lung	Associate	21079520
COVID 19	Associate	35878012
Hypoxia	Stimulate	23667251
Hypoxia	Associate	27002144, 28991229
Hypoxia Brain	Associate	31907278
Infections	Associate	37803001
Leukemia Myeloid Acute	Associate	39611741
Myocardial Ischemia	Associate	27002144
Neoplasms	Associate	27002144, 28991229
Neoplasms	Inhibit	34791795
Neurologic Manifestations	Associate	33053355
Triple Negative Breast Neoplasms	Associate	34791795

EIF4E2 (eukaryotic translation initiation factor 4E family member 2)