Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	947
Gene name	CD34 molecule
Gene symbol	CD34
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q32.2
Summary	The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript v

Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004052	hsa-miR-125a-5p	Luciferase reporter assayMicroarrayWestern blot	18308931
MIRT020428	hsa-miR-106b-5p	Microarray	17242205
MIRT004052	hsa-miR-125a-5p	Reporter assay;Western blot	18308931
MIRT021486	hsa-miR-9-5p	Western blot	18308931
MIRT030549	hsa-miR-24-3p	qRT-PCR	19748357
MIRT875110	hsa-miR-143	CLIP-seq
MIRT875111	hsa-miR-185	CLIP-seq
MIRT875112	hsa-miR-3126-5p	CLIP-seq
MIRT875113	hsa-miR-3150b-3p	CLIP-seq
MIRT875114	hsa-miR-4306	CLIP-seq
MIRT875115	hsa-miR-431	CLIP-seq
MIRT875116	hsa-miR-432	CLIP-seq
MIRT875117	hsa-miR-4419a	CLIP-seq
MIRT875118	hsa-miR-4433	CLIP-seq
MIRT875119	hsa-miR-4443	CLIP-seq
MIRT875120	hsa-miR-4510	CLIP-seq
MIRT875121	hsa-miR-4644	CLIP-seq
MIRT875122	hsa-miR-4711-3p	CLIP-seq
MIRT875123	hsa-miR-4770	CLIP-seq
MIRT875124	hsa-miR-4784	CLIP-seq
MIRT875125	hsa-miR-4785	CLIP-seq
MIRT875126	hsa-miR-665	CLIP-seq
MIRT875127	hsa-miR-765	CLIP-seq
MIRT875128	hsa-miR-1207-5p	CLIP-seq
MIRT875129	hsa-miR-1301	CLIP-seq
MIRT875130	hsa-miR-1321	CLIP-seq
MIRT875131	hsa-miR-1343	CLIP-seq
MIRT875132	hsa-miR-149	CLIP-seq
MIRT875133	hsa-miR-1909	CLIP-seq
MIRT875134	hsa-miR-2276	CLIP-seq
MIRT875135	hsa-miR-3064-5p	CLIP-seq
MIRT875136	hsa-miR-3154	CLIP-seq
MIRT875137	hsa-miR-3922-5p	CLIP-seq
MIRT875138	hsa-miR-3944-5p	CLIP-seq
MIRT875139	hsa-miR-4270	CLIP-seq
MIRT875140	hsa-miR-4326	CLIP-seq
MIRT875117	hsa-miR-4419a	CLIP-seq
MIRT875141	hsa-miR-4434	CLIP-seq
MIRT875142	hsa-miR-4441	CLIP-seq
MIRT875143	hsa-miR-4445	CLIP-seq
MIRT875144	hsa-miR-4447	CLIP-seq
MIRT875145	hsa-miR-4472	CLIP-seq
MIRT875146	hsa-miR-4488	CLIP-seq
MIRT875120	hsa-miR-4510	CLIP-seq
MIRT875147	hsa-miR-4516	CLIP-seq
MIRT875148	hsa-miR-4529-5p	CLIP-seq
MIRT875149	hsa-miR-4537	CLIP-seq
MIRT875150	hsa-miR-4651	CLIP-seq
MIRT875151	hsa-miR-4660	CLIP-seq
MIRT875152	hsa-miR-4685-5p	CLIP-seq
MIRT875153	hsa-miR-4697-5p	CLIP-seq
MIRT875154	hsa-miR-4708-3p	CLIP-seq
MIRT875155	hsa-miR-4728-5p	CLIP-seq
MIRT875156	hsa-miR-4739	CLIP-seq
MIRT875157	hsa-miR-4753-5p	CLIP-seq
MIRT875158	hsa-miR-4756-5p	CLIP-seq
MIRT875159	hsa-miR-4763-3p	CLIP-seq
MIRT875160	hsa-miR-4794	CLIP-seq
MIRT875161	hsa-miR-4795-5p	CLIP-seq
MIRT875162	hsa-miR-486-3p	CLIP-seq
MIRT875163	hsa-miR-5047	CLIP-seq
MIRT875164	hsa-miR-608	CLIP-seq
MIRT1546262	hsa-miR-3529	CLIP-seq
MIRT1546263	hsa-miR-3670	CLIP-seq
MIRT1546264	hsa-miR-379	CLIP-seq
MIRT1546265	hsa-miR-4451	CLIP-seq
MIRT1546266	hsa-miR-4633-3p	CLIP-seq
MIRT1546267	hsa-miR-4650-3p	CLIP-seq
MIRT1546268	hsa-miR-4717-3p	CLIP-seq
MIRT1546269	hsa-miR-4802-3p	CLIP-seq
MIRT1959472	hsa-miR-4723-5p	CLIP-seq
MIRT2196456	hsa-miR-513a-3p	CLIP-seq
MIRT2446580	hsa-miR-1286	CLIP-seq
MIRT875138	hsa-miR-3944-5p	CLIP-seq
MIRT2446581	hsa-miR-4522	CLIP-seq
MIRT2446582	hsa-miR-4722-5p	CLIP-seq
MIRT2446583	hsa-miR-548a-3p	CLIP-seq
MIRT2446584	hsa-miR-548e	CLIP-seq
MIRT2446585	hsa-miR-548f	CLIP-seq
MIRT2446586	hsa-miR-548g	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
MYB	Unknown	7523384
MZF1	Unknown	8585946
RUNX1	Activation	21873977
TAL1	Repression	14715640

Show/Hide all (51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001894	Process	Tissue homeostasis	IDA	12939361
GO:0001935	Process	Endothelial cell proliferation	IDA	21835908
GO:0003094	Process	Glomerular filtration	IEP	20354148
GO:0003158	Process	Endothelium development	IEP	17261663
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	7525669
GO:0005737	Component	Cytoplasm	IEA
GO:0005764	Component	Lysosome	ISS
GO:0005886	Component	Plasma membrane	IDA	1868864, 7525669, 9042286, 17464107
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9042286
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007165	Process	Signal transduction	IEP	17261663
GO:0009897	Component	External side of plasma membrane	IC	15249540
GO:0009897	Component	External side of plasma membrane	IDA	10337918, 12939361, 20354148
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009925	Component	Basal plasma membrane	ISS
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEP	17261663
GO:0010629	Process	Negative regulation of gene expression	IMP	15969628
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0030097	Process	Hemopoiesis	IMP	15969628
GO:0030246	Function	Carbohydrate binding	IDA	15249540
GO:0032703	Process	Negative regulation of interleukin-2 production	IMP	9815891
GO:0035759	Process	Mesangial cell-matrix adhesion	ISS
GO:0036053	Component	Glomerular endothelium fenestra	ISS
GO:0038001	Process	Paracrine signaling	IDA	21835908
GO:0042482	Process	Positive regulation of odontogenesis	IDA	12939361
GO:0043199	Function	Sulfate binding	IEA
GO:0045171	Component	Intercellular bridge	IDA	7525669
GO:0045766	Process	Positive regulation of angiogenesis	IDA	12939361, 21835908
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	7525669
GO:0048870	Process	Cell motility	IEP	17261663
GO:0050900	Process	Leukocyte migration	IEA
GO:0050900	Process	Leukocyte migration	ISS
GO:0060290	Process	Transdifferentiation	IEP	1868864
GO:0061042	Process	Vascular wound healing	IEP	20354148
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	21873977
GO:0071425	Process	Hematopoietic stem cell proliferation	IMP	21873977
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IDA	9815891
GO:0071657	Process	Positive regulation of granulocyte colony-stimulating factor production	IEP	17261663
GO:0071944	Component	Cell periphery	IEA
GO:0071971	Process	Extracellular exosome assembly	IDA	21835908
GO:0072011	Process	Glomerular endothelium development	IEP	17464107
GO:0072089	Process	Stem cell proliferation	IEP	17261663
GO:0072254	Process	Metanephric glomerular mesangial cell differentiation	IEP	1868864
GO:0098609	Process	Cell-cell adhesion	IDA	15249540
GO:2001214	Process	Positive regulation of vasculogenesis	IDA	12939361

MIM	HGNC	e!Ensembl
142230	1662	ENSG00000174059

P28906

Protein name

Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)

Protein function

Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06365	CD34_antigen	190 → 385	CD34/Podocalyxin family	Family

Tissue specificity

TISSUE SPECIFICITY: Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.

Sequence

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL

Sequence length

385

Interactions

View interactions

	KEGG		Reactome
	Cell adhesion molecules Hematopoietic cell lineage		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

CD34 (CD34 molecule)