CD34 (CD34 molecule)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
947
Gene name Gene Name - the full gene name approved by the HGNC.
CD34 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD34
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q32.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene may play a role in the attachment of stem cells to the bone marrow extracellular matrix or to stromal cells. This single-pass membrane protein is highly glycosylated and phosphorylated by protein kinase C. Two transcript v
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(80)
miRTarBase ID miRNA Experiments Reference
MIRT004052 hsa-miR-125a-5p Luciferase reporter assay, Microarray, Western blot 18308931
MIRT020428 hsa-miR-106b-5p Microarray 17242205
MIRT004052 hsa-miR-125a-5p Reporter assay;Western blot 18308931
MIRT021486 hsa-miR-9-5p Western blot 18308931
MIRT030549 hsa-miR-24-3p qRT-PCR 19748357
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
MYB Unknown 7523384
MZF1 Unknown 8585946
RUNX1 Activation 21873977
TAL1 Repression 14715640
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(54)
GO ID Ontology Definition Evidence Reference
GO:0001894 Process Tissue homeostasis IDA 12939361
GO:0001935 Process Endothelial cell proliferation IDA 21835908
GO:0003094 Process Glomerular filtration IEP 20354148
GO:0003158 Process Endothelium development IEP 17261663
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
142230 1662 ENSG00000174059
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P28906
Protein name Hematopoietic progenitor cell antigen CD34 (CD antigen CD34)
Protein function Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans,
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06365 CD34_antigen 190 → 385 CD34/Podocalyxin family Family
Tissue specificity TISSUE SPECIFICITY: Selectively expressed on hematopoietic progenitor cells and the small vessel endothelium of a variety of tissues.
Sequence 
MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQE
TTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTV
FTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGI
REVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRP
QCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLIALVTSGAL
LAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQGKASVNRGAQ
ENGTGQATSRNGHSARQHVVADTEL
Sequence length 385
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cell adhesion molecules
Hematopoietic cell lineage 		  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)		 29059683
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 18180758 ClinVar
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Show/Hide Text Mining Associations (432)
Associations from Text Mining
Disease Name Relationship Type References
Abdominal Injuries Stimulate 21362081
Abdominal Neoplasms Associate 33213169
Abnormal Karyotype Associate 7579382
Abnormalities Drug Induced Associate 19563513
Abortion Spontaneous Inhibit 37968664
Acquired Immunodeficiency Syndrome Associate 26125890, 35216446, 7492764
Acute erythroleukemia Associate 18061959
Adenocarcinoma Associate 20076902, 31760702
Adenocarcinoma of Lung Associate 16153921, 31698633
Adenoma Associate 22824771