Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9464
Gene name Gene Name - the full gene name approved by the HGNC.
Heart and neural crest derivatives expressed 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HAND2
Synonyms (NCBI Gene) Gene synonyms aliases
DHAND2, Hed, Thing2, bHLHa26, dHand
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q34.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular cha
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001843 hsa-miR-1-3p qRT-PCR 21169019
MIRT001843 hsa-miR-1-3p Reporter assay;Other 15951802
MIRT438482 hsa-miR-25-3p Luciferase reporter assay 24161931
MIRT438482 hsa-miR-25-3p Luciferase reporter assay 24161931
MIRT488649 hsa-miR-483-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 16280598, 24161931
GO:0000976 Function Transcription regulatory region sequence-specific DNA binding ISS
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA 21873635
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 16280598
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602407 4808 ENSG00000164107
Protein
UniProt ID P61296
Protein name Heart- and neural crest derivatives-expressed protein 2 (Class A basic helix-loop-helix protein 26) (bHLHa26) (Deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2) (dHAND)
Protein function Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Also plays a
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 100 152 Helix-loop-helix DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Heart.
Sequence
MSLVGGFPHHPVVHHEGYPFAAAAAAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSM
ALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFA
ELRECIPNVPADTKLSKIKTLRLATSYIAYLM
DLLAKDDQNGEAEAFKAEIKKTDVKEEK
RKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
Sequence length 217
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Atrial fibrillation Atrial Fibrillation rs120074192, rs121908590, rs121908593, rs121434558, rs587776851, rs387906612, rs387906613, rs387906614, rs387906615, rs199472687, rs199472705, rs199473324, rs587777336, rs587777339, rs587777557
View all (6 more)
30061737, 29892015, 28416822
Cardiomyopathy Cardiomyopathy, Dilated, Cardiomyopathy, Familial Idiopathic rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
Congenital heart defects Congenital Heart Defects rs267607101, rs121434422, rs387906498, rs397509416, rs587777371, rs587777372, rs587777374, rs367537998, rs797044882, rs886041730, rs768027510, rs1064793873, rs1555447012, rs1554263268, rs1554263321
View all (13 more)
9671575
Dilated cardiomyopathy Familial isolated dilated cardiomyopathy rs267607003, rs267607001, rs267607002, rs267607004, rs119463990, rs587777748, rs119463991, rs119463993, rs119464997, rs267606814, rs121908334, rs121909304, rs1369919728, rs121909295, rs121909297
View all (396 more)
Unknown
Disease term Disease name Evidence References Source
Congestive heart failure Congestive heart failure 29394407 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 29394407 ClinVar
Myocardial infarction Myocardial Failure 29394407 ClinVar
Paroxysmal atrial fibrillation Paroxysmal atrial fibrillation 28416822, 30061737, 29892015 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 28350845
Adenocarcinoma of Lung Associate 24369052
Arthritis Rheumatoid Associate 33549125
Autistic Disorder Associate 29423132
Carcinogenesis Associate 28350845
Carcinogenesis Inhibit 32239802
Carcinoma Hepatocellular Associate 28194035, 32311840, 33566427
Carcinoma Non Small Cell Lung Associate 30509963, 32473628
Carcinoma Non Small Cell Lung Inhibit 32975291
Carcinoma Ovarian Epithelial Associate 39519394