SIGLEC6 (sialic acid binding Ig like lectin 6)

Gene

• Entrez ID: 946
• Gene name: Sialic acid binding Ig like lectin 6
• Gene symbol: SIGLEC6
• Synonyms (NCBI Gene): CD327, CD33L, CD33L1, CD33L2, CDW327, OBBP1
• Chromosome: 19
• Chromosome location: 19q13.41
• Summary: This gene encodes a member of the SIGLEC (sialic acid binding immunoglobulin-like lectin) family of proteins. The encoded transmembrane receptor binds sialyl-TN glycans and leptin. Placental expression of the encoded protein is upregulated in preeclampsia

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2327636	hsa-miR-1283	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25187624, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9465907
GO:0007155	Process	Cell adhesion	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9465907
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9465907
GO:0030246	Function	Carbohydrate binding	IEA
GO:0033691	Function	Sialic acid binding	IBA

Other IDs

• MIM: 604405
• HGNC: 10875
• e!Ensembl: ENSG00000105492

Protein

• UniProt ID: O43699
• Protein name: Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)
• Protein function: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. Binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	34 → 142	Immunoglobulin V-set domain	Domain
  PF00047	ig	150 → 230	Immunoglobulin domain	Domain
  PF07679	I-set	253 → 336	Immunoglobulin I-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at high levels in placenta (cyto- and syncytiotrophoblastic cells) and at lower levels in spleen, peripheral blood leukocytes (predominantly B-cells) and small intestine.
• Sequence:

  MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPAS
  YYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYF
  FRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIF
  SWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQK
  VAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISN
  TGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLV
  FLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISED
  EQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

• Sequence length: 453

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Clear cell carcinoma of kidney	Benign	rs62617068	RCV005910343
Familial cancer of breast	Benign	rs62617068	RCV005910342
Lung cancer	Benign	rs62617068	RCV005910346
Malignant lymphoma, large B-cell, diffuse	Benign	rs62617068	RCV005910344
Prostate cancer	Uncertain significance	rs370040093	RCV000204473
Thyroid cancer, nonmedullary, 1	Benign	rs62617068	RCV005910345
Uterine corpus endometrial carcinoma	Benign	rs62617068	RCV005910347

Associations from Text Mining
Disease Name	Relationship Type	References
Adenocarcinoma of Lung	Associate	37974107
Colorectal Neoplasms	Associate	30294327, 34975867
Gestational Trophoblastic Disease	Associate	23089140
HELLP Syndrome	Associate	20541258
Infections	Associate	34147404
Leukemia Myeloid Acute	Associate	16728277
Lupus Erythematosus Systemic	Associate	26808113
Neoplasms	Associate	34147404
Nevus	Associate	23089140
Pre Eclampsia	Associate	20541258
Urinary Bladder Neoplasms	Stimulate	34147404
Urinary Bladder Neoplasms	Associate	34147404