FHL5 (four and a half LIM domains 5)

Gene

• Entrez ID: 9457
• Gene name: Four and a half LIM domains 5
• Gene symbol: FHL5
• Synonyms (NCBI Gene): 1700027G07Rik, ACT, FHL-5, dJ393D12.2
• Chromosome: 6
• Chromosome location: 6q16.1
• Summary: The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029004	hsa-miR-26b-5p	Microarray	19088304
MIRT1995496	hsa-miR-218	CLIP-seq
MIRT1995497	hsa-miR-3140-3p	CLIP-seq
MIRT1995498	hsa-miR-636	CLIP-seq
MIRT1995499	hsa-miR-3138	CLIP-seq
MIRT1995500	hsa-miR-4318	CLIP-seq
MIRT1995501	hsa-miR-4800-5p	CLIP-seq
MIRT2229500	hsa-miR-1238	CLIP-seq
MIRT2229501	hsa-miR-3616-3p	CLIP-seq
MIRT2229502	hsa-miR-4302	CLIP-seq
MIRT2229503	hsa-miR-4519	CLIP-seq
MIRT2229504	hsa-miR-4721	CLIP-seq
MIRT2229505	hsa-miR-759	CLIP-seq
MIRT2229506	hsa-miR-922	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREM	Unknown	16687568
NFIC	Activation	16565071

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IBA	21873635
GO:0003713	Function	Transcription coactivator activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 23088713, 25910212, 26871637, 28514442, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA	21873635
GO:0030018	Component	Z disc	IBA	21873635
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA	21873635
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 605126
• HGNC: 17371
• e!Ensembl: ENSG00000112214

Protein

• UniProt ID: Q5TD97
• Protein name: Four and a half LIM domains protein 5 (FHL-5) (Activator of cAMP-responsive element modulator in testis) (Activator of CREM in testis)
• Protein function: May be involved in the regulation of spermatogenesis. Stimulates CREM transcriptional activity in a phosphorylation-independent manner.
• PDB: 1X68
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00412	LIM	41 → 98	LIM domain	Domain
  PF00412	LIM	102 → 159	LIM domain	Domain
  PF00412	LIM	163 → 218	LIM domain	Domain
  PF00412	LIM	222 → 279	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific (at protein level). {ECO:0000269|PubMed:11327716}.
• Sequence:

  MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDR
  HWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKG
  NYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQ
  LWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICF
  QDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI

• Sequence length: 284

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	29212778
Migraine	Cervical Migraine Syndrome, Migraine Disorders	rs794727411	23793025, 27182965, 27322543

Unknown
Disease term	Disease name	Evidence	References	Source
Coronary Heart Disease	Coronary Heart Disease			GWAS
Myocardial Infarction	Myocardial Infarction			GWAS
Intracranial Aneurysm	Intracranial Aneurysm			GWAS
Fibromuscular Dysplasia	Fibromuscular Dysplasia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Cluster Headache	Associate	34180076
Diabetes Mellitus	Associate	37452735
Immunologic Deficiency Syndromes	Stimulate	19884660
Lymphohistiocytosis Hemophagocytic	Associate	21152410, 22970278
Migraine Disorders	Associate	26660531, 28627999, 31559635, 33762637, 39333847
Migraine with Aura	Associate	26660531
Migraine without Aura	Associate	33762637
Ovarian Diseases	Associate	31646556
Prostatic Neoplasms	Associate	31682594