LY86 (lymphocyte antigen 86)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9450
Gene name Gene Name - the full gene name approved by the HGNC.
Lymphocyte antigen 86
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LY86
Synonyms (NCBI Gene) Gene synonyms aliases
MD-1, MD1, MMD-1, dJ80N2.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(37)
miRTarBase ID miRNA Experiments Reference
MIRT1123049 hsa-miR-1207-3p CLIP-seq
MIRT1123050 hsa-miR-28-5p CLIP-seq
MIRT1123051 hsa-miR-3139 CLIP-seq
MIRT1123052 hsa-miR-3689d CLIP-seq
MIRT1123053 hsa-miR-4279 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(11)
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 21857663, 32296183
GO:0005576 Component Extracellular region IEA
GO:0006954 Process Inflammatory response IEA
GO:0006955 Process Immune response IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605241 16837 ENSG00000112799
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O95711
Protein name Lymphocyte antigen 86 (Ly-86) (Protein MD-1)
Protein function May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
PDB 3B2D
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in B-cells, monocytes and tonsil.
Sequence 
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Sequence length 162
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Toll Like Receptor 4 (TLR4) Cascade
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Diabetes Type 2 diabetes (age of onset) N/A N/A GWAS
Gastritis Gastritis N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Show/Hide Text Mining Associations (18)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 37482612
Alzheimer Disease Associate 31280115
Carotid Artery Diseases Associate 37861500
Diabetic Retinopathy Associate 37773794
Drug Hypersensitivity Associate 37861500
Hyperplasia Associate 35586138
Inflammation Associate 24735745
Inflammation Inhibit 28203683
Insulin Resistance Associate 24735745
Miyoshi myopathy Associate 33610434