Gene Gene information from NCBI Gene database.
Entrez ID 9450
Gene name Lymphocyte antigen 86
Gene symbol LY86
Synonyms (NCBI Gene)
MD-1MD1MMD-1dJ80N2.1
Chromosome 6
Chromosome location 6p25.1
miRNA miRNA information provided by mirtarbase database.
37
miRTarBase ID miRNA Experiments Reference
MIRT1123049 hsa-miR-1207-3p CLIP-seq
MIRT1123050 hsa-miR-28-5p CLIP-seq
MIRT1123051 hsa-miR-3139 CLIP-seq
MIRT1123052 hsa-miR-3689d CLIP-seq
MIRT1123053 hsa-miR-4279 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 21857663, 32296183
GO:0005576 Component Extracellular region IEA
GO:0006954 Process Inflammatory response IEA
GO:0006955 Process Immune response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605241 16837 ENSG00000112799
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95711
Protein name Lymphocyte antigen 86 (Ly-86) (Protein MD-1)
Protein function May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity).
PDB 3B2D
Family and domains
Tissue specificity TISSUE SPECIFICITY: Highly expressed in B-cells, monocytes and tonsil.
Sequence
MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSK
QLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQI
YYAGPVNNPEFTIPQGEYQVLLELYTEKRSTVACANATIMCS
Sequence length 162
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Toll Like Receptor 4 (TLR4) Cascade