CD33 (CD33 molecule)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 945
Gene name CD33 molecule
Gene symbol CD33
Synonyms (NCBI Gene)
CD33rSiglecSIGLEC-3SIGLEC3p67
Chromosome 19
Chromosome location 19q13.41
miRNA miRNA information provided by mirtarbase database.
7
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (7)
miRTarBase ID miRNA Experiments Reference
MIRT019168 hsa-miR-335-5p Microarray 18185580
MIRT875106 hsa-miR-1253 CLIP-seq
MIRT875107 hsa-miR-3919 CLIP-seq
MIRT875108 hsa-miR-4694-3p CLIP-seq
MIRT875109 hsa-miR-4802-3p CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
MYC Repression 19259613
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
33
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (33)
GO ID Ontology Definition Evidence Reference
GO:0002765 Process Immune response-inhibiting signal transduction IDA 10887109
GO:0005515 Function Protein binding IPI 10206955, 10556798, 17947393, 24216507, 25416956, 28325905, 32296183
GO:0005777 Component Peroxisome IDA 28747436
GO:0005777 Component Peroxisome IEA
GO:0005794 Component Golgi apparatus IDA 21278227
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
159590 1659 ENSG00000105383
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P20138
Protein name Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Protein function Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:11320212, PubMed:15597323). Preferentially recognizes and b
PDB 5IHB , 5J06 , 5J0B , 6D48 , 6D49 , 6D4A , 6TL8 , 7AW6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 → 139 Immunoglobulin V-set domain Domain
PF00047 ig 146 → 227 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Monocytic/myeloid lineage cells. In the brain, CD33 is mainly expressed on microglial cells.
Sequence 
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
Sequence length 364
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Hematopoietic cell lineage   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Neutrophil degranulation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
22
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (15)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Acute myeloid leukemia Benign rs273621 RCV005912966
CD33-related disorder Benign; Likely benign rs273621, rs201074739, rs201473304, rs144102805 RCV003940887
RCV004731581
RCV003976626
RCV004731072
Cervical cancer Benign rs273621 RCV005912968
Clear cell carcinoma of kidney Likely benign rs201473304 RCV005871447
Show/Hide Text Mining Associations (131)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 27050283
AA amyloidosis Associate 23708142, 34208838
Alzheimer Disease Associate 22445811, 23708142, 23946390, 23954108, 25448602, 25670335, 25762156, 26243271, 26414614, 26680604, 27781389, 28005991, 28084078, 28199971, 28747436
View all (30 more)
Alzheimer Disease Stimulate 23226438, 23946390
Anemia Aplastic Associate 8701944
Aortic Aneurysm Abdominal Associate 28735510
Arthritis Rheumatoid Associate 39290322, 39304950
Autoimmune Diseases Associate 33152005
Blast Crisis Associate 34764108
Breast Neoplasms Inhibit 21063401