Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
945
Gene name Gene Name - the full gene name approved by the HGNC.
CD33 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CD33
Synonyms (NCBI Gene) Gene synonyms aliases
CD33rSiglec, SIGLEC-3, SIGLEC3, p67
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.41
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019168 hsa-miR-335-5p Microarray 18185580
MIRT875106 hsa-miR-1253 CLIP-seq
MIRT875107 hsa-miR-3919 CLIP-seq
MIRT875108 hsa-miR-4694-3p CLIP-seq
MIRT875109 hsa-miR-4802-3p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
MYC Repression 19259613
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002765 Process Immune response-inhibiting signal transduction IDA 10887109
GO:0005515 Function Protein binding IPI 10206955, 10556798, 17947393, 24216507, 25416956, 28325905, 32296183
GO:0005777 Component Peroxisome IDA 28747436
GO:0005777 Component Peroxisome IEA
GO:0005794 Component Golgi apparatus IDA 21278227
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
159590 1659 ENSG00000105383
Protein
UniProt ID P20138
Protein name Myeloid cell surface antigen CD33 (Sialic acid-binding Ig-like lectin 3) (Siglec-3) (gp67) (CD antigen CD33)
Protein function Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:11320212, PubMed:15597323). Preferentially recognizes and b
PDB 5IHB , 5J06 , 5J0B , 6D48 , 6D49 , 6D4A , 6TL8 , 7AW6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 24 139 Immunoglobulin V-set domain Domain
PF00047 ig 146 227 Immunoglobulin domain Domain
Tissue specificity TISSUE SPECIFICITY: Monocytic/myeloid lineage cells. In the brain, CD33 is mainly expressed on microglial cells.
Sequence
MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYW
FREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRM
ERGSTKYSYKSPQLSVHVT
DLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWL
SAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTI
QLNVTYVPQNPTT
GIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFFIVKTHRRKAARTAVGRNDTH
PTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSE
VRTQ
Sequence length 364
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Hematopoietic cell lineage   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Dementia Dementia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 27050283
AA amyloidosis Associate 23708142, 34208838
Alzheimer Disease Associate 22445811, 23708142, 23946390, 23954108, 25448602, 25670335, 25762156, 26243271, 26414614, 26680604, 27781389, 28005991, 28084078, 28199971, 28747436
View all (30 more)
Alzheimer Disease Stimulate 23226438, 23946390
Anemia Aplastic Associate 8701944
Aortic Aneurysm Abdominal Associate 28735510
Arthritis Rheumatoid Associate 39290322, 39304950
Autoimmune Diseases Associate 33152005
Blast Crisis Associate 34764108
Breast Neoplasms Inhibit 21063401