Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9446
Gene name	Glutathione S-transferase omega 1
Gene symbol	GSTO1
Synonyms (NCBI Gene)	GSTO 1-1GSTTLp28HEL-S-21P28SPG-R
Chromosome	10
Chromosome location	10q25.1
Summary	The protein encoded by this gene is an omega class glutathione S-transferase (GST) with glutathione-dependent thiol transferase and dehydroascorbate reductase activities. GSTs are involved in the metabolism of xenobiotics and carcinogens. The encoded prot

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023892	hsa-miR-1-3p	Proteomics	18668040
MIRT048048	hsa-miR-197-3p	CLASH	23622248
MIRT2007347	hsa-miR-1252	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	11511179
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005515	Function	Protein binding	IPI	25277244
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11511179
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	11035031
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IDA	11035031
GO:0014810	Process	Positive regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion	IDA	11035031
GO:0016491	Function	Oxidoreductase activity	IDA	11511179
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019852	Process	L-ascorbic acid metabolic process	IBA
GO:0019852	Process	L-ascorbic acid metabolic process	IDA	11511179
GO:0019852	Process	L-ascorbic acid metabolic process	IEA
GO:0042178	Process	Xenobiotic catabolic process	IDA	12928150
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IBA
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IDA	11511179
GO:0045174	Function	Glutathione dehydrogenase (ascorbate) activity	IEA
GO:0050610	Function	Methylarsonate reductase activity	IEA
GO:0051280	Process	Negative regulation of release of sequestered calcium ion into cytosol	IDA	11035031
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	11035031
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:0071243	Process	Cellular response to arsenic-containing substance	IDA	11511179
GO:0071243	Process	Cellular response to arsenic-containing substance	IEA
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
605482	13312	ENSG00000148834

P78417

Protein name

Glutathione S-transferase omega-1 (GSTO-1) (EC 2.5.1.18) (Glutathione S-transferase omega 1-1) (GSTO 1-1) (Glutathione-dependent dehydroascorbate reductase) (EC 1.8.5.1) (Monomethylarsonic acid reductase) (MMA(V) reductase) (EC 1.20.4.2) (S-(Phenacyl)glut

Protein function

Exhibits glutathione-dependent thiol transferase and dehydroascorbate reductase activities. Has S-(phenacyl)glutathione reductase activity. Also has glutathione S-transferase activity. Participates in the biotransformation of inorganic arsenic a

PDB

1EEM , 3LFL , 3VLN , 4IS0 , 4YQM , 4YQU , 4YQV , 5UEH , 5V3Q , 5YVN , 5YVO , 6MHB , 6MHC , 6MHD , 6PNM , 6PNN , 6PNO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13417	GST_N_3	26 → 101	Glutathione S-transferase, N-terminal domain	Domain
PF14497	GST_C_3	108 → 219	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highest expression in liver, pancreas, skeletal muscle, spleen, thymus, colon, blood leukocyte and heart. Lowest expression in brain, placenta and lung. {ECO:0000269|PubMed:10783391}.

Sequence

MSGESARSLGKGSAPPGPVPEGSIRIYSMRFCPFAERTRLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLNECVDHTPKLKLWMAAMKEDPTVSALLTSEKDWQGFLELYLQNSPEACDYG
L

Sequence length

241

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Methylation Glutathione conjugation Vitamin C (ascorbate) metabolism Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs629771	RCV005911999
Cervical cancer	Benign	rs629771	RCV005912001
Colon adenocarcinoma	Benign	rs629771	RCV005911998
Colorectal cancer	Benign	rs629771	RCV005912002
Familial cancer of breast	Benign	rs629771	RCV005911997
Gastric cancer	Benign	rs629771	RCV005912004
GSTO1-related disorder	Benign; Likely benign	rs4925, rs72323784	RCV003974574 RCV003976559
Malignant tumor of esophagus	Benign	rs629771	RCV005912000
Sarcoma	Benign	rs629771	RCV005912003
Thymoma	Benign	rs629771	RCV005912005
Uterine corpus endometrial carcinoma	Benign	rs629771	RCV005912006

Show/Hide Text Mining Associations (37)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	24417908
Alzheimer Disease	Associate	15040808, 15985314
Breast Neoplasms	Associate	23888047, 30873742
Carcinoma Hepatocellular	Stimulate	27221910
Carcinoma Non Small Cell Lung	Associate	28425245, 33236161
Carcinoma Renal Cell	Associate	30224590
Carcinoma Transitional Cell	Associate	28288548
Cardiomyopathy Hypertrophic	Associate	31243064
Cognition Disorders	Associate	27259244
Colorectal Neoplasms	Associate	26046795, 27703239, 36129143
Death	Associate	24040330, 28425245
Dementia	Associate	39596595
Diabetes Mellitus	Associate	36676788
Drug Related Side Effects and Adverse Reactions	Associate	26354850
Esophageal Squamous Cell Carcinoma	Stimulate	25085586
Fetal Growth Retardation	Associate	27330572
Fibrosis	Stimulate	27221910
Hematuria	Associate	26354850
Hepatitis B	Associate	27221910
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23819933, 30873742
Hypertension	Associate	30224590
Hypertrophy Left Ventricular	Associate	31243064
Infertility Male	Associate	22045430
Ischemia	Associate	19624857
Lupus Erythematosus Systemic	Associate	27257790
Mitochondrial Diseases	Associate	30873742
Neoplasm Metastasis	Associate	30873742
Neoplasms	Associate	21798077, 23819933, 25085586, 27703239, 28228260, 28288548, 30224590
Neoplasms	Stimulate	21798077, 33236161, 35297370
Neurodegenerative Diseases	Associate	30224590
Non Muscle Invasive Bladder Neoplasms	Associate	24040330
Parkinson Disease	Associate	15040808, 15985314
Parkinson Disease	Inhibit	17194543
Pulmonary Disease Chronic Obstructive	Associate	36051533
Renal Insufficiency Chronic	Associate	31924810
Urethral Neoplasms	Associate	21798077, 25103078
Urinary Bladder Neoplasms	Associate	24040330, 26354850

GSTO1 (glutathione S-transferase omega 1)