Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9445
Gene name Gene Name - the full gene name approved by the HGNC.
Integral membrane protein 2B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ITM2B
Synonyms (NCBI Gene) Gene synonyms aliases
ABRI, BRI, BRI2, BRICD2B, E25B, E3-16, FBD, RDGCA, imBRI2
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q14.2
Summary Summary of gene provided in NCBI Entrez Gene.
Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by f
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs104894417 T>A Pathogenic Stop lost, terminator codon variant
rs606231166 ->TTAATTTGTT Pathogenic Frameshift variant, coding sequence variant
rs606231283 A>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT028344 hsa-miR-32-5p Sequencing 20371350
MIRT052500 hsa-let-7a-5p CLASH 23622248
MIRT050305 hsa-miR-25-3p CLASH 23622248
MIRT048657 hsa-miR-99a-5p CLASH 23622248
MIRT048501 hsa-miR-100-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0001540 Function Amyloid-beta binding IBA
GO:0001540 Function Amyloid-beta binding IPI 19849849
GO:0005515 Function Protein binding IPI 16027166, 17965014, 23701002, 25416956, 28514442, 31695625, 32814053, 33961781, 34446781
GO:0005524 Function ATP binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603904 6174 ENSG00000136156
Protein
UniProt ID Q9Y287
Protein name Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C
Protein function Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a
PDB 8RNU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 139 230 BRICHOS domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Expressed in brain.
Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFG
LAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIK
IFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNL
LELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYK
LQRRETIKGI
QKREASNCFAIRHFENKFAVETLICS
Sequence length 266
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amyloid fiber formation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
ADan amyloidosis adan amyloidosis rs606231166 N/A
Retinal Dystrophy With Inner Retinal Dysfunction And Ganglion Cell Anomalies retinal dystrophy with inner retinal dysfunction and ganglion cell anomalies rs606231283 N/A
Cerebral amyloid angiopathy abri amyloidosis rs104894417 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Severe insulin-deficient type 2 diabetes N/A N/A GWAS
Hypertension Resistant hypertension N/A N/A GWAS
vascular dementia Vascular dementia N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 10781099, 11159188, 18282158, 25336154, 36102248
Alzheimer Disease Associate 15983050, 16027166, 21752865, 21841249, 25336154, 32555390, 34446781, 36102248
Amyloid angiopathy Associate 16027166
Amyloidosis Associate 29455155
Amyloidosis Familial Associate 29455155
Autoimmune Hypophysitis Associate 31611368
Cardiovascular Diseases Associate 31611368
Cerebellar Ataxia Associate 34446781
Cerebral Amyloid Angiopathy Associate 11159188, 36102248
Cerebral Hemorrhage Associate 16027166