Gene Gene information from NCBI Gene database.
Entrez ID 9445
Gene name Integral membrane protein 2B
Gene symbol ITM2B
Synonyms (NCBI Gene)
ABRIBRIBRI2BRICD2BE25BE3-16FBDRDGCAimBRI2
Chromosome 13
Chromosome location 13q14.2
Summary Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by f
SNPs SNP information provided by dbSNP.
3
SNP ID Visualize variation Clinical significance Consequence
rs104894417 T>A Pathogenic Stop lost, terminator codon variant
rs606231166 ->TTAATTTGTT Pathogenic Frameshift variant, coding sequence variant
rs606231283 A>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
308
miRTarBase ID miRNA Experiments Reference
MIRT028344 hsa-miR-32-5p Sequencing 20371350
MIRT052500 hsa-let-7a-5p CLASH 23622248
MIRT050305 hsa-miR-25-3p CLASH 23622248
MIRT048657 hsa-miR-99a-5p CLASH 23622248
MIRT048501 hsa-miR-100-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0001540 Function Amyloid-beta binding IBA
GO:0001540 Function Amyloid-beta binding IPI 19849849
GO:0005515 Function Protein binding IPI 16027166, 17965014, 23701002, 25416956, 28514442, 31695625, 32814053, 33961781, 34446781
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603904 6174 ENSG00000136156
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y287
Protein name Integral membrane protein 2B (Immature BRI2) (imBRI2) (Protein E25B) (Transmembrane protein BRI) (Bri) [Cleaved into: BRI2, membrane form (Mature BRI2) (mBRI2); BRI2 intracellular domain (BRI2 ICD); BRI2C, soluble form; Bri23 peptide (Bri2-23) (ABri23) (C
Protein function Plays a regulatory role in the processing of the amyloid-beta A4 precursor protein (APP) and acts as an inhibitor of the amyloid-beta peptide aggregation and fibrils deposition. Plays a role in the induction of neurite outgrowth. Functions as a
PDB 8RNU
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04089 BRICHOS 139 230 BRICHOS domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Expressed in brain.
Sequence
MVKVTFNSALAQKEAKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFG
LAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIK
IFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNL
LELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYK
LQRRETIKGI
QKREASNCFAIRHFENKFAVETLICS
Sequence length 266
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Amyloid fiber formation
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
16
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ABri amyloidosis Likely pathogenic; Pathogenic rs2137997888, rs104894417 RCV001809239
RCV000006345
ADan amyloidosis Pathogenic rs606231166 RCV000006346
Retinal dystrophy with inner retinal dysfunction and ganglion cell anomalies Pathogenic rs606231283 RCV000144939
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
ITM2B-related disorder Uncertain significance; Benign; Conflicting classifications of pathogenicity rs1335111071, rs751018650, rs755757477, rs769773974, rs1951787726, rs144217555 RCV003399156
RCV003893070
RCV003971081
RCV004756378
RCV003899091
RCV003898011
Optic atrophy Uncertain significance rs903269829 RCV004818433
Vascular dementia Uncertain significance rs1951769958 RCV001263183
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 10781099, 11159188, 18282158, 25336154, 36102248
Alzheimer Disease Associate 15983050, 16027166, 21752865, 21841249, 25336154, 32555390, 34446781, 36102248
Amyloid angiopathy Associate 16027166
Amyloidosis Associate 29455155
Amyloidosis Familial Associate 29455155
Autoimmune Hypophysitis Associate 31611368
Cardiovascular Diseases Associate 31611368
Cerebellar Ataxia Associate 34446781
Cerebral Amyloid Angiopathy Associate 11159188, 36102248
Cerebral Hemorrhage Associate 16027166