Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9441
Gene name Gene Name - the full gene name approved by the HGNC.	Mediator complex subunit 26
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	MED26
Synonyms (NCBI Gene) Gene synonyms aliases	CRSP7, CRSP70
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. T

Show/Hide all(230)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044629	hsa-miR-320a	CLASH	23622248
MIRT564305	hsa-miR-9500	PAR-CLIP	20371350
MIRT564304	hsa-miR-4719	PAR-CLIP	20371350
MIRT564303	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT564302	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT564301	hsa-miR-4419a	PAR-CLIP	20371350
MIRT564300	hsa-miR-4510	PAR-CLIP	20371350
MIRT564299	hsa-miR-6127	PAR-CLIP	20371350
MIRT564298	hsa-miR-6129	PAR-CLIP	20371350
MIRT564297	hsa-miR-6130	PAR-CLIP	20371350
MIRT564296	hsa-miR-6133	PAR-CLIP	20371350
MIRT564294	hsa-miR-6077	PAR-CLIP	20371350
MIRT564295	hsa-miR-2052	PAR-CLIP	20371350
MIRT564293	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT564292	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT564291	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT564290	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT564289	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT564288	hsa-miR-8055	PAR-CLIP	20371350
MIRT564305	hsa-miR-9500	PAR-CLIP	20371350
MIRT564304	hsa-miR-4719	PAR-CLIP	20371350
MIRT564303	hsa-miR-3126-5p	PAR-CLIP	20371350
MIRT564302	hsa-miR-6875-5p	PAR-CLIP	20371350
MIRT564301	hsa-miR-4419a	PAR-CLIP	20371350
MIRT564300	hsa-miR-4510	PAR-CLIP	20371350
MIRT564299	hsa-miR-6127	PAR-CLIP	20371350
MIRT564298	hsa-miR-6129	PAR-CLIP	20371350
MIRT564297	hsa-miR-6130	PAR-CLIP	20371350
MIRT564296	hsa-miR-6133	PAR-CLIP	20371350
MIRT564294	hsa-miR-6077	PAR-CLIP	20371350
MIRT564295	hsa-miR-2052	PAR-CLIP	20371350
MIRT564293	hsa-miR-513b-5p	PAR-CLIP	20371350
MIRT564292	hsa-miR-6834-5p	PAR-CLIP	20371350
MIRT564291	hsa-miR-1226-5p	PAR-CLIP	20371350
MIRT564290	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT564289	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT564288	hsa-miR-8055	PAR-CLIP	20371350
MIRT1141453	hsa-miR-103a	CLIP-seq
MIRT1141454	hsa-miR-107	CLIP-seq
MIRT1141455	hsa-miR-1183	CLIP-seq
MIRT1141456	hsa-miR-1200	CLIP-seq
MIRT1141457	hsa-miR-1237	CLIP-seq
MIRT1141458	hsa-miR-124	CLIP-seq
MIRT1141459	hsa-miR-129-5p	CLIP-seq
MIRT1141460	hsa-miR-1301	CLIP-seq
MIRT1141461	hsa-miR-1304	CLIP-seq
MIRT1141462	hsa-miR-146a	CLIP-seq
MIRT1141463	hsa-miR-146b-5p	CLIP-seq
MIRT1141464	hsa-miR-15a	CLIP-seq
MIRT1141465	hsa-miR-15b	CLIP-seq
MIRT1141466	hsa-miR-16	CLIP-seq
MIRT1141467	hsa-miR-181a	CLIP-seq
MIRT1141468	hsa-miR-181b	CLIP-seq
MIRT1141469	hsa-miR-181c	CLIP-seq
MIRT1141470	hsa-miR-181d	CLIP-seq
MIRT1141471	hsa-miR-186	CLIP-seq
MIRT1141472	hsa-miR-195	CLIP-seq
MIRT1141473	hsa-miR-219-2-3p	CLIP-seq
MIRT1141474	hsa-miR-29a	CLIP-seq
MIRT1141475	hsa-miR-29b	CLIP-seq
MIRT1141476	hsa-miR-29c	CLIP-seq
MIRT1141477	hsa-miR-3125	CLIP-seq
MIRT1141478	hsa-miR-3133	CLIP-seq
MIRT1141479	hsa-miR-3134	CLIP-seq
MIRT1141480	hsa-miR-3692	CLIP-seq
MIRT1141481	hsa-miR-3714	CLIP-seq
MIRT1141482	hsa-miR-3910	CLIP-seq
MIRT1141483	hsa-miR-3916	CLIP-seq
MIRT1141484	hsa-miR-424	CLIP-seq
MIRT1141485	hsa-miR-425	CLIP-seq
MIRT1141486	hsa-miR-4251	CLIP-seq
MIRT1141487	hsa-miR-4262	CLIP-seq
MIRT1141488	hsa-miR-4310	CLIP-seq
MIRT1141489	hsa-miR-4324	CLIP-seq
MIRT1141490	hsa-miR-4448	CLIP-seq
MIRT1141491	hsa-miR-4470	CLIP-seq
MIRT1141492	hsa-miR-4509	CLIP-seq
MIRT1141493	hsa-miR-450b-5p	CLIP-seq
MIRT1141494	hsa-miR-4520a-5p	CLIP-seq
MIRT1141495	hsa-miR-4520b-5p	CLIP-seq
MIRT1141496	hsa-miR-4524	CLIP-seq
MIRT1141497	hsa-miR-4534	CLIP-seq
MIRT1141498	hsa-miR-4696	CLIP-seq
MIRT1141499	hsa-miR-4729	CLIP-seq
MIRT1141500	hsa-miR-4744	CLIP-seq
MIRT1141501	hsa-miR-4773	CLIP-seq
MIRT1141502	hsa-miR-4790-3p	CLIP-seq
MIRT1141503	hsa-miR-497	CLIP-seq
MIRT1141504	hsa-miR-503	CLIP-seq
MIRT1141505	hsa-miR-5047	CLIP-seq
MIRT1141506	hsa-miR-506	CLIP-seq
MIRT1141507	hsa-miR-507	CLIP-seq
MIRT1141508	hsa-miR-513a-3p	CLIP-seq
MIRT1141509	hsa-miR-513b	CLIP-seq
MIRT1141510	hsa-miR-518a-5p	CLIP-seq
MIRT1141511	hsa-miR-522	CLIP-seq
MIRT1141512	hsa-miR-527	CLIP-seq
MIRT1141513	hsa-miR-539	CLIP-seq
MIRT1141514	hsa-miR-544b	CLIP-seq
MIRT1141515	hsa-miR-548a-3p	CLIP-seq
MIRT1141516	hsa-miR-548aa	CLIP-seq
MIRT1141517	hsa-miR-548ac	CLIP-seq
MIRT1141518	hsa-miR-548ae	CLIP-seq
MIRT1141519	hsa-miR-548aj	CLIP-seq
MIRT1141520	hsa-miR-548am	CLIP-seq
MIRT1141521	hsa-miR-548d-3p	CLIP-seq
MIRT1141522	hsa-miR-548e	CLIP-seq
MIRT1141523	hsa-miR-548f	CLIP-seq
MIRT1141524	hsa-miR-548g	CLIP-seq
MIRT1141525	hsa-miR-548x	CLIP-seq
MIRT1141526	hsa-miR-548z	CLIP-seq
MIRT1141527	hsa-miR-557	CLIP-seq
MIRT1141528	hsa-miR-582-3p	CLIP-seq
MIRT1141529	hsa-miR-589	CLIP-seq
MIRT1141530	hsa-miR-646	CLIP-seq
MIRT1141531	hsa-miR-7	CLIP-seq
MIRT1141480	hsa-miR-3692	CLIP-seq
MIRT1141499	hsa-miR-4729	CLIP-seq
MIRT2040132	hsa-miR-1207-3p	CLIP-seq
MIRT2040133	hsa-miR-1224-3p	CLIP-seq
MIRT1141457	hsa-miR-1237	CLIP-seq
MIRT2040134	hsa-miR-1243	CLIP-seq
MIRT2040135	hsa-miR-1248	CLIP-seq
MIRT1141459	hsa-miR-129-5p	CLIP-seq
MIRT2040136	hsa-miR-1827	CLIP-seq
MIRT2040137	hsa-miR-193a-3p	CLIP-seq
MIRT2040138	hsa-miR-193b	CLIP-seq
MIRT2040139	hsa-miR-2276	CLIP-seq
MIRT2040140	hsa-miR-296-5p	CLIP-seq
MIRT2040141	hsa-miR-3128	CLIP-seq
MIRT2040142	hsa-miR-3186-3p	CLIP-seq
MIRT2040143	hsa-miR-3612	CLIP-seq
MIRT2040144	hsa-miR-3619-3p	CLIP-seq
MIRT2040145	hsa-miR-3654	CLIP-seq
MIRT2040146	hsa-miR-3667-3p	CLIP-seq
MIRT2040147	hsa-miR-3680	CLIP-seq
MIRT2040148	hsa-miR-3976	CLIP-seq
MIRT2040149	hsa-miR-4436b-5p	CLIP-seq
MIRT1141493	hsa-miR-450b-5p	CLIP-seq
MIRT2040150	hsa-miR-4539	CLIP-seq
MIRT2040151	hsa-miR-4652-3p	CLIP-seq
MIRT2040152	hsa-miR-4680-5p	CLIP-seq
MIRT2040153	hsa-miR-4695-5p	CLIP-seq
MIRT2040154	hsa-miR-4707-3p	CLIP-seq
MIRT2040155	hsa-miR-4707-5p	CLIP-seq
MIRT2040156	hsa-miR-4720-5p	CLIP-seq
MIRT2040157	hsa-miR-4763-5p	CLIP-seq
MIRT2040158	hsa-miR-4772-3p	CLIP-seq
MIRT2040159	hsa-miR-4776-5p	CLIP-seq
MIRT2040160	hsa-miR-4778-3p	CLIP-seq
MIRT2040161	hsa-miR-4799-3p	CLIP-seq
MIRT1141507	hsa-miR-507	CLIP-seq
MIRT2040162	hsa-miR-544	CLIP-seq
MIRT2040163	hsa-miR-548p	CLIP-seq
MIRT1141527	hsa-miR-557	CLIP-seq
MIRT2040164	hsa-miR-650	CLIP-seq
MIRT2040165	hsa-miR-941	CLIP-seq
MIRT2269987	hsa-miR-101	CLIP-seq
MIRT1141453	hsa-miR-103a	CLIP-seq
MIRT1141454	hsa-miR-107	CLIP-seq
MIRT1141455	hsa-miR-1183	CLIP-seq
MIRT1141456	hsa-miR-1200	CLIP-seq
MIRT1141457	hsa-miR-1237	CLIP-seq
MIRT1141459	hsa-miR-129-5p	CLIP-seq
MIRT1141461	hsa-miR-1304	CLIP-seq
MIRT2269988	hsa-miR-141	CLIP-seq
MIRT1141462	hsa-miR-146a	CLIP-seq
MIRT1141463	hsa-miR-146b-5p	CLIP-seq
MIRT1141464	hsa-miR-15a	CLIP-seq
MIRT1141465	hsa-miR-15b	CLIP-seq
MIRT1141466	hsa-miR-16	CLIP-seq
MIRT1141467	hsa-miR-181a	CLIP-seq
MIRT1141468	hsa-miR-181b	CLIP-seq
MIRT1141469	hsa-miR-181c	CLIP-seq
MIRT1141470	hsa-miR-181d	CLIP-seq
MIRT2040137	hsa-miR-193a-3p	CLIP-seq
MIRT2040138	hsa-miR-193b	CLIP-seq
MIRT1141472	hsa-miR-195	CLIP-seq
MIRT2269989	hsa-miR-200a	CLIP-seq
MIRT2269990	hsa-miR-3120-3p	CLIP-seq
MIRT2269991	hsa-miR-3176	CLIP-seq
MIRT2269992	hsa-miR-3922-3p	CLIP-seq
MIRT1141484	hsa-miR-424	CLIP-seq
MIRT1141485	hsa-miR-425	CLIP-seq
MIRT1141486	hsa-miR-4251	CLIP-seq
MIRT1141487	hsa-miR-4262	CLIP-seq
MIRT2269993	hsa-miR-4287	CLIP-seq
MIRT1141488	hsa-miR-4310	CLIP-seq
MIRT1141489	hsa-miR-4324	CLIP-seq
MIRT1141490	hsa-miR-4448	CLIP-seq
MIRT1141493	hsa-miR-450b-5p	CLIP-seq
MIRT1141494	hsa-miR-4520a-5p	CLIP-seq
MIRT1141495	hsa-miR-4520b-5p	CLIP-seq
MIRT2269994	hsa-miR-4685-3p	CLIP-seq
MIRT1141503	hsa-miR-497	CLIP-seq
MIRT1141507	hsa-miR-507	CLIP-seq
MIRT1141509	hsa-miR-513b	CLIP-seq
MIRT1141510	hsa-miR-518a-5p	CLIP-seq
MIRT1141512	hsa-miR-527	CLIP-seq
MIRT1141514	hsa-miR-544b	CLIP-seq
MIRT1141516	hsa-miR-548aa	CLIP-seq
MIRT2040163	hsa-miR-548p	CLIP-seq
MIRT1141527	hsa-miR-557	CLIP-seq
MIRT1141529	hsa-miR-589	CLIP-seq
MIRT2390790	hsa-miR-3132	CLIP-seq
MIRT2390791	hsa-miR-3652	CLIP-seq
MIRT2390792	hsa-miR-4430	CLIP-seq
MIRT2390793	hsa-miR-4505	CLIP-seq
MIRT2269987	hsa-miR-101	CLIP-seq
MIRT1141458	hsa-miR-124	CLIP-seq
MIRT2569070	hsa-miR-2113	CLIP-seq
MIRT1141474	hsa-miR-29a	CLIP-seq
MIRT1141475	hsa-miR-29b	CLIP-seq
MIRT1141476	hsa-miR-29c	CLIP-seq
MIRT2269990	hsa-miR-3120-3p	CLIP-seq
MIRT2569071	hsa-miR-3679-3p	CLIP-seq
MIRT1141481	hsa-miR-3714	CLIP-seq
MIRT1141482	hsa-miR-3910	CLIP-seq
MIRT1141491	hsa-miR-4470	CLIP-seq
MIRT1141492	hsa-miR-4509	CLIP-seq
MIRT1141500	hsa-miR-4744	CLIP-seq
MIRT2569072	hsa-miR-4758-3p	CLIP-seq
MIRT1141506	hsa-miR-506	CLIP-seq
MIRT1141516	hsa-miR-548aa	CLIP-seq
MIRT2569073	hsa-miR-599	CLIP-seq
MIRT2269987	hsa-miR-101	CLIP-seq
MIRT2269990	hsa-miR-3120-3p	CLIP-seq
MIRT2569071	hsa-miR-3679-3p	CLIP-seq
MIRT2569072	hsa-miR-4758-3p	CLIP-seq
MIRT1141516	hsa-miR-548aa	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IDA	15989967
GO:0003713	Function	Transcription coactivator activity	TAS	9989412
GO:0005515	Function	Protein binding	IPI	15175163, 20111005, 21729782, 24882805, 24981860, 25281560, 28514442, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	15989967
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	9989412
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	TAS	9989412
GO:0010628	Process	Positive regulation of gene expression	IBA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IDA	15989967
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0070847	Component	Core mediator complex	IBA
GO:0070847	Component	Core mediator complex	IPI	24882805

MIM	HGNC	e!Ensembl
605043	2376	ENSG00000105085

Protein

UniProt ID

O95402

Protein name

Mediator of RNA polymerase II transcription subunit 26 (Activator-recruited cofactor 70 kDa component) (ARC70) (Cofactor required for Sp1 transcriptional activation subunit 7) (CRSP complex subunit 7) (Mediator complex subunit 26) (Transcriptional coactiv

Protein function

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN

PDB

5ODD , 6ZV3 , 7EMF , 7ENA , 7ENC , 7ENJ , 8GXQ , 8GXS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08711	Med26	33 → 84	TFIIS helical bundle-like domain	Domain
PF15694	Med26_M	177 → 417	Mediator complex subunit 26 middle domain	Domain
PF15693	Med26_C	419 → 598	Mediator complex subunit 26 C-terminal	Domain

Sequence

MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDV
RKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGP
PRSIHDLKSRNDLQRLPGQRLDRLGSRKRRGDQRDLGHPGPPPKVSKASHDPLVPNSSPL
PTNGISGSPESFASSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPG
PCLQPKASVLQQLDRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSP
SPRPQALDATQVPSPLPLAQPSTPPVRRLELLPSAESPVCWLEQPESHQRLAGPGCKAGL
SPAEPLLSRAGFSPDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRL
KERKLTFDPMTRQIKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKEL
SRNEIIQSYLSRQSSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDL
PGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD

Sequence length

600

Interactions

View interactions

	Reactome
			PPARA activates gene expression Generic Transcription Pathway Transcriptional regulation of white adipocyte differentiation

MED26 (mediator complex subunit 26)