Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	944
Gene name Gene Name - the full gene name approved by the HGNC.	TNF superfamily member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TNFSF8
Synonyms (NCBI Gene) Gene synonyms aliases	CD153, CD30L, CD30LG, TNLG3A
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9q32-q33.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancie

Show/Hide all(49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT665107	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT665106	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT650735	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT650734	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT650732	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT650733	hsa-miR-4267	HITS-CLIP	23824327
MIRT650731	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT650730	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT650729	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT650728	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT650727	hsa-miR-5696	HITS-CLIP	23824327
MIRT650726	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT650725	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT650723	hsa-miR-9500	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT665107	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT665106	hsa-miR-2681-5p	HITS-CLIP	23824327
MIRT650735	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT650734	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT650732	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT650733	hsa-miR-4267	HITS-CLIP	23824327
MIRT650731	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT650730	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT650729	hsa-miR-205-5p	HITS-CLIP	23824327
MIRT650728	hsa-miR-342-3p	HITS-CLIP	23824327
MIRT650727	hsa-miR-5696	HITS-CLIP	23824327
MIRT650726	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT650725	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT650724	hsa-miR-4724-5p	HITS-CLIP	23824327
MIRT650723	hsa-miR-9500	HITS-CLIP	23824327
MIRT650721	hsa-miR-2115-5p	HITS-CLIP	23824327
MIRT1443570	hsa-miR-1228	CLIP-seq
MIRT1443571	hsa-miR-128	CLIP-seq
MIRT1443572	hsa-miR-1284	CLIP-seq
MIRT1443573	hsa-miR-140-3p	CLIP-seq
MIRT1443574	hsa-miR-30a	CLIP-seq
MIRT1443575	hsa-miR-30b	CLIP-seq
MIRT1443576	hsa-miR-30c	CLIP-seq
MIRT1443577	hsa-miR-30d	CLIP-seq
MIRT1443578	hsa-miR-30e	CLIP-seq
MIRT1443579	hsa-miR-3115	CLIP-seq
MIRT1443580	hsa-miR-629	CLIP-seq
MIRT2132742	hsa-miR-2053	CLIP-seq
MIRT2353820	hsa-miR-1243	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	TAS	8391931
GO:0005125	Function	Cytokine activity	IEA
GO:0005164	Function	Tumor necrosis factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	TAS	8391931
GO:0006955	Process	Immune response	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8391931
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0042129	Process	Regulation of T cell proliferation	TAS	8391931
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IBA
GO:0043374	Process	CD8-positive, alpha-beta T cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA

MIM	HGNC	e!Ensembl
603875	11938	ENSG00000106952

Protein

UniProt ID

P32971

Protein name

Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30-L) (CD antigen CD153)

Protein function

Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00229	TNF	113 → 230	TNF(Tumour Necrosis Factor) family	Domain

Sequence

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Sequence length

234

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		TNFs bind their physiological receptors

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Crohn Disease	Crohn's disease	N/A	N/A	GWAS

Show/Hide Text Mining Associations (38)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	35948079
Anodontia	Associate	8896393
Bone Diseases	Associate	19657367
Carcinoma Basal Cell	Associate	17268792
Carcinoma Non Small Cell Lung	Associate	21170350
Dermatitis Atopic	Associate	16964309
Glucagonoma	Associate	9058727
Hematologic Neoplasms	Associate	9058727
Hemoglobinuria Paroxysmal	Associate	28630090
Hereditary leiomyomatosis and renal cell cancer	Associate	11815953, 8701986, 8896393
HIV Infections	Associate	7648397
Hodgkin Disease	Associate	11815953, 8701986, 8896393, 9058727
Hypereosinophilic Syndrome	Stimulate	8896393
Inflammation	Associate	16964309, 22033252
Leukemia	Associate	11175813
Leukemia B Cell	Associate	9058727
Leukemia Hairy Cell	Associate	9058727
Leukemia Large Granular Lymphocytic	Associate	10887130
Leukemia Lymphocytic Chronic B Cell	Associate	11175813, 9058727
Leukemia Lymphoma Adult T Cell	Associate	9058727
Leukemia Myeloid Acute	Stimulate	9058727
Leukemia Prolymphocytic T Cell	Associate	9058727
Liver Cirrhosis Biliary	Associate	29773854
Lung Neoplasms	Associate	21292647
Lymphoma B Cell	Associate	9058727
Lymphoma Large Cell Anaplastic	Associate	11121138, 8701986
Lymphoma Non Hodgkin	Associate	9058727
Lymphomatoid Papulosis	Associate	11121138
Melanoma Cutaneous Malignant	Associate	19626699
Multiple Myeloma	Associate	19657367, 9058727
Neoplasms	Associate	9058727
Pancreatic Neoplasms	Associate	35030986
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	9058727
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11918534
Psoriasis	Associate	16964309
Skin Diseases	Associate	16964309
Spondylarthritis	Associate	21480186
Uterine Cervical Neoplasms	Associate	31511581

TNFSF8 (TNF superfamily member 8)