Gene Gene information from NCBI Gene database.
Entrez ID 944
Gene name TNF superfamily member 8
Gene symbol TNFSF8
Synonyms (NCBI Gene)
CD153CD30LCD30LGTNLG3A
Chromosome 9
Chromosome location 9q32-q33.1
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancie
miRNA miRNA information provided by mirtarbase database.
49
miRTarBase ID miRNA Experiments Reference
MIRT650724 hsa-miR-4724-5p HITS-CLIP 23824327
MIRT665107 hsa-miR-6510-5p HITS-CLIP 23824327
MIRT650721 hsa-miR-2115-5p HITS-CLIP 23824327
MIRT665106 hsa-miR-2681-5p HITS-CLIP 23824327
MIRT650735 hsa-miR-1228-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IEA
GO:0005102 Function Signaling receptor binding TAS 8391931
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603875 11938 ENSG00000106952
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P32971
Protein name Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30-L) (CD antigen CD153)
Protein function Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 113 230 TNF(Tumour Necrosis Factor) family Domain
Sequence
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLY
SNSD
Sequence length 234
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors