TNFSF8 (TNF superfamily member 8)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
944
Gene name Gene Name - the full gene name approved by the HGNC.
TNF superfamily member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TNFSF8
Synonyms (NCBI Gene) Gene synonyms aliases
CD153, CD30L, CD30LG, TNLG3A
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q32-q33.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancie
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(49)
miRTarBase ID miRNA Experiments Reference
MIRT650724 hsa-miR-4724-5p HITS-CLIP 23824327
MIRT665107 hsa-miR-6510-5p HITS-CLIP 23824327
MIRT650721 hsa-miR-2115-5p HITS-CLIP 23824327
MIRT665106 hsa-miR-2681-5p HITS-CLIP 23824327
MIRT650735 hsa-miR-1228-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(14)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding TAS 8391931
GO:0005125 Function Cytokine activity IEA
GO:0005164 Function Tumor necrosis factor receptor binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005615 Component Extracellular space IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603875 11938 ENSG00000106952
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P32971
Protein name Tumor necrosis factor ligand superfamily member 8 (CD30 ligand) (CD30-L) (CD antigen CD153)
Protein function Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00229 TNF 113 → 230 TNF(Tumour Necrosis Factor) family Domain
Sequence 
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Sequence length 234
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction   TNFs bind their physiological receptors
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (2)
Unknown
Disease term Disease name Evidence References Source
Crohn disease Crohn Disease 23266558, 16221758 ClinVar
Crohn Disease Crohn Disease GWAS
Show/Hide Text Mining Associations (38)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35948079
Anodontia Associate 8896393
Bone Diseases Associate 19657367
Carcinoma Basal Cell Associate 17268792
Carcinoma Non Small Cell Lung Associate 21170350
Dermatitis Atopic Associate 16964309
Glucagonoma Associate 9058727
Hematologic Neoplasms Associate 9058727
Hemoglobinuria Paroxysmal Associate 28630090
Hereditary leiomyomatosis and renal cell cancer Associate 11815953, 8701986, 8896393