NCR1 (natural cytotoxicity triggering receptor 1)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9437
Gene name Gene Name - the full gene name approved by the HGNC.
Natural cytotoxicity triggering receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NCR1
Synonyms (NCBI Gene) Gene synonyms aliases
CD335, LY94, NK-p46, NKP46
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19q13.42
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(9)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 17056548, 28480349
GO:0005886 Component Plasma membrane TAS
GO:0005887 Component Integral component of plasma membrane NAS 9730896
GO:0006968 Process Cellular defense response TAS 9730896
GO:0007165 Process Signal transduction TAS 9730896
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
604530 6731 ENSG00000189430
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O76036
Protein name Natural cytotoxicity triggering receptor 1 (Lymphocyte antigen 94 homolog) (NK cell-activating receptor) (Natural killer cell p46-related protein) (NK-p46) (NKp46) (hNKp46) (CD antigen CD335)
Protein function Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
PDB 1OLL , 1P6F , 6IAP
Family and domains
Tissue specificity TISSUE SPECIFICITY: Selectively expressed by both resting and activated NK cells. {ECO:0000269|PubMed:9730896}.
Sequence 
MSSTLPALLCVGLCLSQRISAQQQTLPKPFIWAEPHFMVPKEKQVTICCQGNYGAVEYQL
HFEGSLFAVDRPKPPERINKVKFYIPDMNSRMAGQYSCIYRVGELWSEPSNLLDLVVTEM
YDTPTLSVHPGPEVISGEKVTFYCRLDTATSMFLLLKEGRSSHVQRGYGKVQAEFPLGPV
TTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPADTWGTYLLTTET
GLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLN
TQTL
Sequence length 304
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Natural killer cell mediated cytotoxicity   Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Text Mining Associations (91)
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 24807109
Acute On Chronic Liver Failure Associate 26241657
Addison Disease Associate 28223394
Amyotrophic Lateral Sclerosis Associate 38626361
Arthritis Rheumatoid Associate 24673109
Arthritis Rheumatoid Inhibit 32246007
Asthma Stimulate 18581330
Bone Diseases Associate 32246007
Brain Neoplasms Associate 33420630
Breast Neoplasms Inhibit 35633551