PPP1R14A (protein phosphatase 1 regulatory inhibitor subunit 14A)

Gene

• Entrez ID: 94274
• Gene name: Protein phosphatase 1 regulatory inhibitor subunit 14A
• Gene symbol: PPP1R14A
• Synonyms (NCBI Gene): CPI-17, CPI17, PPP1INL
• Chromosome: 19
• Chromosome location: 19q13.2
• Summary: The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044653	hsa-miR-320a	CLASH	23622248
MIRT485984	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT485983	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT485982	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT485981	hsa-miR-4467	PAR-CLIP	23592263
MIRT485979	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT485980	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT485978	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT485977	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT485976	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT485984	hsa-miR-6784-5p	PAR-CLIP	23592263
MIRT485983	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT485982	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT485981	hsa-miR-4467	PAR-CLIP	23592263
MIRT485979	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT485980	hsa-miR-486-3p	PAR-CLIP	23592263
MIRT485978	hsa-miR-328-5p	PAR-CLIP	23592263
MIRT485977	hsa-miR-6885-5p	PAR-CLIP	23592263
MIRT485976	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT2302035	hsa-miR-130a	CLIP-seq
MIRT2302036	hsa-miR-130b	CLIP-seq
MIRT2302037	hsa-miR-301a	CLIP-seq
MIRT2302038	hsa-miR-301b	CLIP-seq
MIRT2302039	hsa-miR-3666	CLIP-seq
MIRT2302040	hsa-miR-4270	CLIP-seq
MIRT2302041	hsa-miR-4295	CLIP-seq
MIRT2302042	hsa-miR-4441	CLIP-seq
MIRT2302043	hsa-miR-454	CLIP-seq
MIRT2302044	hsa-miR-4693-3p	CLIP-seq
MIRT2302045	hsa-miR-4696	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004864	Function	Protein phosphatase inhibitor activity	IEA
GO:0004865	Function	Protein serine/threonine phosphatase inhibitor activity	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA

Other IDs

• MIM: 608153
• HGNC: 14871
• e!Ensembl: ENSG00000167641

Protein

• UniProt ID: Q96A00
• Protein name: Protein phosphatase 1 regulatory subunit 14A (17 kDa PKC-potentiated inhibitory protein of PP1) (Protein kinase C-potentiated inhibitor protein of 17 kDa) (CPI-17)
• Protein function: Inhibitor of PPP1CA. Has over 1000-fold higher inhibitory activity when phosphorylated, creating a molecular switch for regulating the phosphorylation status of PPP1CA substrates and smooth muscle contraction.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05361	PP1_inhibitor	1 → 136	PKC-activated protein phosphatase-1 inhibitor	Family

• Tissue specificity: TISSUE SPECIFICITY: Isoform 1 is detected in aorta and testis. Isoform 2 is detected in aorta. {ECO:0000269|PubMed:11467857}.
• Sequence:

  MAAQRLGKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWIDGRL
  EELYRGMEADMPDEINIDELLELESEEERSRKIQGLLKSCGKPVEDFIQELLAKLQGLHR
  QPGLRQPSPSHDGSLSPLQDRARTAHP

• Sequence length: 147

Pathways

KEGG:

Vascular smooth muscle contraction

Reactome:

RHO GTPases activate PKNs