Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9425
Gene name Gene Name - the full gene name approved by the HGNC.
Chromodomain Y like
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDYL
Synonyms (NCBI Gene) Gene synonyms aliases
CDYL1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.1
Summary Summary of gene provided in NCBI Entrez Gene.
Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by r
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006174 hsa-miR-141-3p Luciferase reporter assay, Western blot 21867514
MIRT006174 hsa-miR-141-3p Luciferase reporter assay, Western blot 21867514
MIRT006174 hsa-miR-141-3p Luciferase reporter assay, Western blot 21867514
MIRT735364 hsa-miR-1180-3p Luciferase reporter assay, Western blotting, qRT-PCR 32321304
MIRT882877 hsa-miR-3154 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IEA
GO:0003682 Function Chromatin binding ISS
GO:0003714 Function Transcription corepressor activity IBA
GO:0003714 Function Transcription corepressor activity IMP 19061646
GO:0005515 Function Protein binding IPI 16415788, 19061646, 21653829, 22009739, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603778 1811 ENSG00000153046
Protein
UniProt ID Q9Y232
Protein name Chromodomain Y-like protein (CDY-like) (Crotonyl-CoA hydratase) (EC 4.2.1.-)
Protein function [Isoform 2]: Chromatin reader protein that recognizes and binds histone H3 trimethylated at 'Lys-9', dimethylated at 'Lys-27' and trimethylated at 'Lys-27' (H3K9me3, H3K27me2 and H3K27me3, respectively) (PubMed:19808672, PubMed:28402439). Part o
PDB 2DNT , 2GTR , 7N27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 61 112 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF00378 ECH_1 347 598 Enoyl-CoA hydratase/isomerase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the hippocampus with reduced expression in epileptic tissue compared to normal adjacent tissue (at protein level) (PubMed:28842554). Ubiquitous (PubMed:19808672). Expressed at moderate levels in all tissues examined (PubMe
Sequence
MTFQASHRSAWGKSRKKNWQYEGPTQKLFLKRNNVSAPDGPSDPSISVSSEQSGAQQPPA
LQVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKES
TLTRTNRTSPNNARKQISRSTNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPS
LSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKP
VGALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLAVNGKGTSPFMDALTANGTTN
IQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTK
SSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRES
TKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKEL
ASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF
Sequence length 598
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Prostate cancer Prostate cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 30961553
Gastroschisis Associate 31075877
Intestinal Pseudo Obstruction Associate 30961553
Neoplasms Associate 30961553
Neoplasms Inhibit 30968727
Urinary Bladder Neoplasms Inhibit 30968727
Uterine Cervical Neoplasms Associate 19061646