Gene Gene information from NCBI Gene database.
Entrez ID 9425
Gene name Chromodomain Y like
Gene symbol CDYL
Synonyms (NCBI Gene)
CDYL1
Chromosome 6
Chromosome location 6p25.1
Summary Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by r
miRNA miRNA information provided by mirtarbase database.
124
miRTarBase ID miRNA Experiments Reference
MIRT006174 hsa-miR-141-3p Luciferase reporter assayWestern blot 21867514
MIRT006174 hsa-miR-141-3p Luciferase reporter assayWestern blot 21867514
MIRT006174 hsa-miR-141-3p Luciferase reporter assayWestern blot 21867514
MIRT735364 hsa-miR-1180-3p Luciferase reporter assayWestern blottingqRT-PCR 32321304
MIRT882877 hsa-miR-3154 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
27
GO ID Ontology Definition Evidence Reference
GO:0003682 Function Chromatin binding IEA
GO:0003682 Function Chromatin binding ISS
GO:0003714 Function Transcription corepressor activity IBA
GO:0003714 Function Transcription corepressor activity IMP 19061646
GO:0005515 Function Protein binding IPI 16415788, 19061646, 21653829, 22009739, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603778 1811 ENSG00000153046
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9Y232
Protein name Chromodomain Y-like protein (CDY-like) (Crotonyl-CoA hydratase) (EC 4.2.1.-)
Protein function [Isoform 2]: Chromatin reader protein that recognizes and binds histone H3 trimethylated at 'Lys-9', dimethylated at 'Lys-27' and trimethylated at 'Lys-27' (H3K9me3, H3K27me2 and H3K27me3, respectively) (PubMed:19808672, PubMed:28402439). Part o
PDB 2DNT , 2GTR , 7N27
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00385 Chromo 61 112 Chromo (CHRromatin Organisation MOdifier) domain Domain
PF00378 ECH_1 347 598 Enoyl-CoA hydratase/isomerase Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in the hippocampus with reduced expression in epileptic tissue compared to normal adjacent tissue (at protein level) (PubMed:28842554). Ubiquitous (PubMed:19808672). Expressed at moderate levels in all tissues examined (PubMe
Sequence
MTFQASHRSAWGKSRKKNWQYEGPTQKLFLKRNNVSAPDGPSDPSISVSSEQSGAQQPPA
LQVERIVDKRKNKKGKTEYLVRWKGYDSEDDTWEPEQHLVNCEEYIHDFNRRHTEKQKES
TLTRTNRTSPNNARKQISRSTNSNFSKTSPKALVIGKDHESKNSQLFAASQKFRKNTAPS
LSSRKNMDLAKSGIKILVPKSPVKSRTAVDGFQSESPEKLDPVEQGQEDTVAPEVAAEKP
VGALLGPGAERARMGSRPRIHPLVPQVPGPVTAAMATGLAVNGKGTSPFMDALTANGTTN
IQTSVTGVTASKRKFIDDRRDQPFDKRLRFSVRQTESAYRYRDIVVRKQDGFTHILLSTK
SSENNSLNPEVMREVQSALSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRRLTDDRKRES
TKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKAWFQTPYTTFGQ
SPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVMVRIKEL
ASCNPVVLEESKALVRCNMKMELEQANERECEVLKKIWGSAQGMDSMLKYLQRKIDEF
Sequence length 598
Interactions View interactions