Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
94234
Gene name Gene Name - the full gene name approved by the HGNC.
Forkhead box Q1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FOXQ1
Synonyms (NCBI Gene) Gene synonyms aliases
HFH1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p25.3
Summary Summary of gene provided in NCBI Entrez Gene.
FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expre
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018393 hsa-miR-335-5p Microarray 18185580
MIRT030583 hsa-miR-24-3p Microarray 19748357
MIRT485590 hsa-miR-106a-5p PAR-CLIP 23592263
MIRT485589 hsa-miR-17-5p PAR-CLIP 23592263
MIRT485588 hsa-miR-20a-5p PAR-CLIP 23592263
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612788 20951 ENSG00000164379
Protein
UniProt ID Q9C009
Protein name Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1)
Protein function Plays a role in hair follicle differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 118 205 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the stomach, trachea, bladder and salivary gland. {ECO:0000269|PubMed:11747606}.
Sequence
MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFA
DGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA
Sequence length 403
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
27129776
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
27129776
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
27129776
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 22761930, 31116002
Breast Neoplasms Stimulate 23555880, 32754922
Breast Neoplasms Associate 27786176, 34939230, 35512572, 36319643, 36778115, 37265428, 38062011
Carcinogenesis Associate 25955104, 33174020, 34939230, 35114976
Carcinoma Hepatocellular Associate 31853229
Carcinoma Non Small Cell Lung Associate 22761930, 31713908
Carcinoma Non Small Cell Lung Stimulate 23203039
Carcinoma Ovarian Epithelial Associate 23203039
Colorectal Neoplasms Stimulate 23555880, 25955104
Colorectal Neoplasms Associate 31137244, 35114976, 35633908, 36124643