Gene Gene information from NCBI Gene database.
Entrez ID 94234
Gene name Forkhead box Q1
Gene symbol FOXQ1
Synonyms (NCBI Gene)
HFH1
Chromosome 6
Chromosome location 6p25.3
Summary FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expre
miRNA miRNA information provided by mirtarbase database.
161
miRTarBase ID miRNA Experiments Reference
MIRT018393 hsa-miR-335-5p Microarray 18185580
MIRT030583 hsa-miR-24-3p Microarray 19748357
MIRT485590 hsa-miR-106a-5p PAR-CLIP 23592263
MIRT485589 hsa-miR-17-5p PAR-CLIP 23592263
MIRT485588 hsa-miR-20a-5p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612788 20951 ENSG00000164379
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9C009
Protein name Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1)
Protein function Plays a role in hair follicle differentiation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00250 Forkhead 118 205 Forkhead domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in the stomach, trachea, bladder and salivary gland. {ECO:0000269|PubMed:11747606}.
Sequence
MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFA
DGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA
Sequence length 403
Interactions View interactions