Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	94234
Gene name Gene Name - the full gene name approved by the HGNC.	Forkhead box Q1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	FOXQ1
Synonyms (NCBI Gene) Gene synonyms aliases	HFH1
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p25.3
Summary Summary of gene provided in NCBI Entrez Gene.	FOXQ1 is a member of the FOX gene family, which is characterized by a conserved 110-amino acid DNA-binding motif called the forkhead or winged helix domain. FOX genes are involved in embryonic development, cell cycle regulation, tissue-specific gene expre

Show/Hide all(161)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018393	hsa-miR-335-5p	Microarray	18185580
MIRT030583	hsa-miR-24-3p	Microarray	19748357
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT485589	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT485584	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485574	hsa-miR-3666	PAR-CLIP	23592263
MIRT485573	hsa-miR-4295	PAR-CLIP	23592263
MIRT485572	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485570	hsa-miR-3973	PAR-CLIP	23592263
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT485569	hsa-miR-520h	PAR-CLIP	23592263
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT485567	hsa-miR-378j	PAR-CLIP	23592263
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT485565	hsa-miR-4320	PAR-CLIP	23592263
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT485562	hsa-miR-937-3p	PAR-CLIP	23592263
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485557	hsa-miR-5706	PAR-CLIP	23592263
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT485555	hsa-miR-527	PAR-CLIP	23592263
MIRT737398	hsa-miR-422a	Luciferase reporter assay, Northern blot,	25251503
MIRT731745	hsa-miR-1271-5p	Luciferase reporter assay, qRT-PCR, Western blot	26159618
MIRT731745	hsa-miR-1271-5p	Luciferase reporter assay, qRT-PCR, Western blot	26159618
MIRT408575	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26935526
MIRT408575	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	26935526
MIRT408575	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25856555
MIRT408575	hsa-miR-506-3p	Luciferase reporter assay, qRT-PCR, Western blot	25856555
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	27292025
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	27292025
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	27292025
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	27292025
MIRT485589	hsa-miR-17-5p	PAR-CLIP	27292025
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	27292025
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	27292025
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	27292025
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	27292025
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	27292025
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	27292025
MIRT485574	hsa-miR-3666	PAR-CLIP	27292025
MIRT485567	hsa-miR-378j	PAR-CLIP	27292025
MIRT485570	hsa-miR-3973	PAR-CLIP	27292025
MIRT485573	hsa-miR-4295	PAR-CLIP	27292025
MIRT485565	hsa-miR-4320	PAR-CLIP	27292025
MIRT485572	hsa-miR-454-3p	PAR-CLIP	27292025
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	27292025
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	27292025
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	27292025
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	27292025
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	27292025
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	27292025
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	27292025
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	27292025
MIRT485569	hsa-miR-520h	PAR-CLIP	27292025
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	27292025
MIRT485555	hsa-miR-527	PAR-CLIP	27292025
MIRT485557	hsa-miR-5706	PAR-CLIP	27292025
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	27292025
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	27292025
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	27292025
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	27292025
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	27292025
MIRT485584	hsa-miR-93-5p	PAR-CLIP	27292025
MIRT485562	hsa-miR-937-3p	PAR-CLIP	27292025
MIRT485590	hsa-miR-106a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31897182
MIRT737029	hsa-miR-106a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31897182
MIRT485562	hsa-miR-937-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31417280
MIRT737398	hsa-miR-422a	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), RNA-seq, qRT-PCR, In situ hybridization	32061262
MIRT485590	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT485589	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT485588	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT485587	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT485586	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT485585	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT485584	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT485583	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT485582	hsa-miR-6507-3p	PAR-CLIP	23592263
MIRT485581	hsa-miR-519a-3p	PAR-CLIP	23592263
MIRT485580	hsa-miR-519b-3p	PAR-CLIP	23592263
MIRT485579	hsa-miR-519c-3p	PAR-CLIP	23592263
MIRT485578	hsa-miR-130a-3p	PAR-CLIP	23592263
MIRT485577	hsa-miR-130b-3p	PAR-CLIP	23592263
MIRT485576	hsa-miR-301a-3p	PAR-CLIP	23592263
MIRT485575	hsa-miR-301b-3p	PAR-CLIP	23592263
MIRT485574	hsa-miR-3666	PAR-CLIP	23592263
MIRT485573	hsa-miR-4295	PAR-CLIP	23592263
MIRT485572	hsa-miR-454-3p	PAR-CLIP	23592263
MIRT485570	hsa-miR-3973	PAR-CLIP	23592263
MIRT485571	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT485569	hsa-miR-520h	PAR-CLIP	23592263
MIRT485568	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT485567	hsa-miR-378j	PAR-CLIP	23592263
MIRT485566	hsa-miR-6839-5p	PAR-CLIP	23592263
MIRT485565	hsa-miR-4320	PAR-CLIP	23592263
MIRT485564	hsa-miR-19a-3p	PAR-CLIP	23592263
MIRT485563	hsa-miR-19b-3p	PAR-CLIP	23592263
MIRT485562	hsa-miR-937-3p	PAR-CLIP	23592263
MIRT485561	hsa-miR-7111-3p	PAR-CLIP	23592263
MIRT485560	hsa-miR-6780a-3p	PAR-CLIP	23592263
MIRT485559	hsa-miR-6881-3p	PAR-CLIP	23592263
MIRT485558	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT485557	hsa-miR-5706	PAR-CLIP	23592263
MIRT485556	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT485555	hsa-miR-527	PAR-CLIP	23592263
MIRT756454	hsa-miR-378a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	36457036
MIRT1003663	hsa-miR-106a	CLIP-seq
MIRT1003664	hsa-miR-106b	CLIP-seq
MIRT1003665	hsa-miR-130a	CLIP-seq
MIRT1003666	hsa-miR-130b	CLIP-seq
MIRT1003667	hsa-miR-17	CLIP-seq
MIRT1003668	hsa-miR-199a-3p	CLIP-seq
MIRT1003669	hsa-miR-199b-3p	CLIP-seq
MIRT1003670	hsa-miR-19a	CLIP-seq
MIRT1003671	hsa-miR-19b	CLIP-seq
MIRT1003672	hsa-miR-20a	CLIP-seq
MIRT1003673	hsa-miR-20b	CLIP-seq
MIRT1003674	hsa-miR-301a	CLIP-seq
MIRT1003675	hsa-miR-301b	CLIP-seq
MIRT1003676	hsa-miR-3064-3p	CLIP-seq
MIRT1003677	hsa-miR-3129-5p	CLIP-seq
MIRT1003678	hsa-miR-3190	CLIP-seq
MIRT1003679	hsa-miR-342-3p	CLIP-seq
MIRT1003680	hsa-miR-3660	CLIP-seq
MIRT1003681	hsa-miR-3911	CLIP-seq
MIRT1003682	hsa-miR-3978	CLIP-seq
MIRT1003683	hsa-miR-4264	CLIP-seq
MIRT1003684	hsa-miR-4488	CLIP-seq
MIRT1003685	hsa-miR-451b	CLIP-seq
MIRT1003686	hsa-miR-4526	CLIP-seq
MIRT1003687	hsa-miR-454	CLIP-seq
MIRT1003688	hsa-miR-4697-5p	CLIP-seq
MIRT1003689	hsa-miR-4704-3p	CLIP-seq
MIRT1003690	hsa-miR-4729	CLIP-seq
MIRT1003691	hsa-miR-519a	CLIP-seq
MIRT1003692	hsa-miR-519d	CLIP-seq
MIRT1003693	hsa-miR-520g	CLIP-seq
MIRT1003694	hsa-miR-593	CLIP-seq
MIRT1003695	hsa-miR-602	CLIP-seq
MIRT1003696	hsa-miR-619	CLIP-seq
MIRT1003697	hsa-miR-648	CLIP-seq
MIRT1003698	hsa-miR-875-3p	CLIP-seq
MIRT1003699	hsa-miR-93	CLIP-seq
MIRT1997510	hsa-miR-296-5p	CLIP-seq
MIRT1997511	hsa-miR-4532	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0009653	Process	Anatomical structure morphogenesis	IBA
GO:0030154	Process	Cell differentiation	IBA
GO:0031069	Process	Hair follicle morphogenesis	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
612788	20951	ENSG00000164379

Protein

UniProt ID

Q9C009

Protein name

Forkhead box protein Q1 (HNF-3/forkhead-like protein 1) (HFH-1) (Hepatocyte nuclear factor 3 forkhead homolog 1)

Protein function

Plays a role in hair follicle differentiation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00250	Forkhead	118 → 205	Forkhead domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in the stomach, trachea, bladder and salivary gland. {ECO:0000269|PubMed:11747606}.

Sequence

MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANSPAAGGGARDT
QGDGEQSAGGGPGAEEAIPAAAAAAVVAEGAEAGAAGPGAGGAGSGEGARSKPYTRRPKP
PYSYIALIAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKV
LRDPSRPWGKDNYWMLNPNSEYTFADGVFRRRRKRLSHRAPVPAPGLRPEEAPGLPAAPP
PAPAAPASPRMRSPARQEERASPAGKFSSSFAIDSILRKPFRSRRLRDTAPGTTLQWGAA
PCPPLPAFPALLPAAPCRALLPLCAYGAGEPARLGAREAEVPPTAPPLLLAPLPAAAPAK
PLRGPAAGGAHLYCPLRLPAALQAASVRRPGPHLPYPVETLLA

Sequence length

403

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Breast cancer	Breast cancer	N/A	N/A	GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	22761930, 31116002
Breast Neoplasms	Stimulate	23555880, 32754922
Breast Neoplasms	Associate	27786176, 34939230, 35512572, 36319643, 36778115, 37265428, 38062011
Carcinogenesis	Associate	25955104, 33174020, 34939230, 35114976
Carcinoma Hepatocellular	Associate	31853229
Carcinoma Non Small Cell Lung	Associate	22761930, 31713908
Carcinoma Non Small Cell Lung	Stimulate	23203039
Carcinoma Ovarian Epithelial	Associate	23203039
Colorectal Neoplasms	Stimulate	23555880, 25955104
Colorectal Neoplasms	Associate	31137244, 35114976, 35633908, 36124643
Diabetes Mellitus	Associate	36978091
Diabetic Nephropathies	Associate	36978091
Esophageal Neoplasms	Associate	28726780
Glycosuria Renal	Associate	36978091
Hypersensitivity Immediate	Associate	34939230
Hypersensitivity Immediate	Stimulate	37265428
Inflammation	Associate	28726780
Lymphatic Metastasis	Associate	23609035, 31713908
Lymphatic Metastasis	Stimulate	25955104
Mammary Neoplasms Animal	Associate	34939230
Mast Cell Activation Disorders	Associate	37762215
Mastocytosis	Associate	37762215
Mastocytosis Systemic	Associate	37762215
Nasopharyngeal Carcinoma	Associate	25856555, 33875643
Neoplasm Metastasis	Associate	25856555, 25955104, 28791370, 35396504, 36124643, 36319643
Neoplasm Metastasis	Stimulate	35633908, 37875474
Neoplasms	Associate	23203039, 23349834, 23555880, 23609035, 25856555, 25955104, 26159618, 28726780, 28791370, 31713908, 32412910, 36124643, 36319643, 37875474
Osteogenesis Imperfecta	Associate	37021796
Osteoporosis	Associate	36050744
Ovarian Neoplasms	Associate	23203039, 24200849, 32977853
Pancreatic Neoplasms	Stimulate	37875474
Stomach Neoplasms	Associate	23609035, 26159618, 28791370
Tertiary Lymphoid Structures	Associate	23609035
Triple Negative Breast Neoplasms	Associate	36319643, 38062011
Urinary Bladder Neoplasms	Associate	35396504
Uterine Cervical Neoplasms	Associate	27363024

FOXQ1 (forkhead box Q1)