Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	942
Gene name Gene Name - the full gene name approved by the HGNC.	CD86 molecule
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CD86
Synonyms (NCBI Gene) Gene synonyms aliases	B7-2, B7.2, B70, CD28LG2, LAB72
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q13.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymph

Show/Hide all(86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021271	hsa-miR-146a-5p	Other	20375304
MIRT022558	hsa-miR-124-3p	Microarray	18668037
MIRT659681	hsa-miR-496	HITS-CLIP	23824327
MIRT659680	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT659678	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT659679	hsa-miR-376b-5p	HITS-CLIP	23824327
MIRT659677	hsa-miR-376c-5p	HITS-CLIP	23824327
MIRT659676	hsa-miR-3691-5p	HITS-CLIP	23824327
MIRT659675	hsa-miR-8056	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT659674	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT659673	hsa-miR-4752	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT659672	hsa-miR-8081	HITS-CLIP	23824327
MIRT659671	hsa-miR-8055	HITS-CLIP	23824327
MIRT639534	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT732964	hsa-miR-200a-3p	qRT-PCR	33788641
MIRT736409	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT659681	hsa-miR-496	HITS-CLIP	23824327
MIRT659680	hsa-miR-3156-5p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT659678	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT659679	hsa-miR-376b-5p	HITS-CLIP	23824327
MIRT659677	hsa-miR-376c-5p	HITS-CLIP	23824327
MIRT659676	hsa-miR-3691-5p	HITS-CLIP	23824327
MIRT659675	hsa-miR-8056	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT659674	hsa-miR-6869-5p	HITS-CLIP	23824327
MIRT659673	hsa-miR-4752	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT659672	hsa-miR-8081	HITS-CLIP	23824327
MIRT659671	hsa-miR-8055	HITS-CLIP	23824327
MIRT639534	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT639533	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT639532	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT639531	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT639529	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT639530	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT639528	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT639527	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT876374	hsa-miR-3194-5p	CLIP-seq
MIRT876375	hsa-miR-4640-5p	CLIP-seq
MIRT876376	hsa-miR-4690-3p	CLIP-seq
MIRT876377	hsa-miR-4726-5p	CLIP-seq
MIRT876378	hsa-miR-662	CLIP-seq
MIRT876379	hsa-miR-1236	CLIP-seq
MIRT876380	hsa-miR-1301	CLIP-seq
MIRT876381	hsa-miR-202	CLIP-seq
MIRT876382	hsa-miR-3123	CLIP-seq
MIRT876383	hsa-miR-3157-5p	CLIP-seq
MIRT876384	hsa-miR-3183	CLIP-seq
MIRT876385	hsa-miR-4520a-3p	CLIP-seq
MIRT876386	hsa-miR-4520b-3p	CLIP-seq
MIRT876387	hsa-miR-4529-3p	CLIP-seq
MIRT876388	hsa-miR-4660	CLIP-seq
MIRT876389	hsa-miR-4678	CLIP-seq
MIRT876390	hsa-miR-4691-3p	CLIP-seq
MIRT876391	hsa-miR-4723-3p	CLIP-seq
MIRT876392	hsa-miR-5047	CLIP-seq
MIRT876393	hsa-miR-516b	CLIP-seq
MIRT876394	hsa-miR-665	CLIP-seq
MIRT876395	hsa-miR-765	CLIP-seq
MIRT2196775	hsa-miR-4461	CLIP-seq
MIRT2385805	hsa-miR-125a-5p	CLIP-seq
MIRT2385806	hsa-miR-125b	CLIP-seq
MIRT2385807	hsa-miR-4319	CLIP-seq
MIRT2385808	hsa-miR-4732-3p	CLIP-seq
MIRT2385809	hsa-miR-4733-3p	CLIP-seq
MIRT2385810	hsa-miR-4738-3p	CLIP-seq
MIRT2385811	hsa-miR-670	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
NFKB1	Activation	15895390;15949284;18929846;19164127
NFKB1	Unknown	10586028
RELA	Activation	15895390;15949284;18929846;19164127
RELA	Unknown	10586028
STAT1	Unknown	10773351
TRERF1	Repression	18652845

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002377	Process	Immunoglobulin production	ISS
GO:0005515	Function	Protein binding	IPI	9915850, 11279501, 21982860, 25241761
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA	21873635
GO:0007166	Process	Cell surface receptor signaling pathway	IBA	21873635
GO:0007202	Process	Activation of phospholipase C activity	ISS
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7513726
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0009986	Component	Cell surface	HDA	23981064
GO:0015026	Function	Coreceptor activity	NAS	9915850
GO:0016021	Component	Integral component of membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0023035	Process	CD40 signaling pathway	ISS
GO:0031295	Process	T cell costimulation	IBA	21873635
GO:0031295	Process	T cell costimulation	TAS
GO:0032743	Process	Positive regulation of interleukin-2 production	NAS	9915850
GO:0032753	Process	Positive regulation of interleukin-4 production	NAS	9915850
GO:0032761	Process	Positive regulation of lymphotoxin A production	NAS	9915850
GO:0034451	Component	Centriolar satellite	IDA
GO:0038023	Function	Signaling receptor activity	TAS	7694363
GO:0042102	Process	Positive regulation of T cell proliferation	IBA	21873635
GO:0042113	Process	B cell activation	ISS
GO:0042130	Process	Negative regulation of T cell proliferation	IBA	21873635
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	NAS	9915850
GO:0045893	Process	Positive regulation of transcription, DNA-templated	NAS	9915850
GO:0046718	Process	Viral entry into host cell	IEA
GO:0051897	Process	Positive regulation of protein kinase B signaling	TAS
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070062	Component	Extracellular exosome	IDA	15908444
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	ISS
GO:1990051	Process	Activation of protein kinase C activity	ISS

MIM	HGNC	e!Ensembl
601020	1705	ENSG00000114013

Protein

UniProt ID

P42081

Protein name

T-lymphocyte activation antigen CD86 (Activation B7-2 antigen) (B70) (BU63) (CTLA-4 counter-receptor B7.2) (FUN-1) (CD antigen CD86)

Protein function

Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4 (PubMed:12196291). May play a critical role in the early events of T-cell activation and costimulation

PDB

1I85 , 1NCN , 5YXK , 8FXX , 8FXY , 8HXB , 8HXC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07686	V-set	24 → 132	Immunoglobulin V-set domain	Domain
PF13895	Ig_2	138 → 236	Immunoglobulin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed by activated B-lymphocytes and monocytes.

Sequence

MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQ
ENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGM
IRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTI
EYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQ
PPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSYKCGTNTMEREESEQTKKREK
IHIPERSDEAQRVFKSSKTSSCDKSDTCF

Sequence length

329

Interactions

View interactions

	KEGG		Reactome
	Virion - Adenovirus Cell adhesion molecules Toll-like receptor signaling pathway Intestinal immune network for IgA production Type I diabetes mellitus Kaposi sarcoma-associated herpesvirus infection Transcriptional misregulation in cancer Autoimmune thyroid disease Systemic lupus erythematosus Rheumatoid arthritis Allograft rejection Graft-versus-host disease Viral myocarditis		PIP3 activates AKT signaling Constitutive Signaling by Aberrant PI3K in Cancer CD28 co-stimulation CD28 dependent PI3K/Akt signaling CD28 dependent Vav1 pathway CTLA4 inhibitory signaling Interleukin-10 signaling PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Dermatitis	Contact Dermatitis	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	25724174
Diffuse lymphoma	Diffuse Large B-Cell Lymphoma	rs121912651, rs121913289, rs121913293, rs878854402, rs869025340, rs1349928568, rs1569115687, rs121913291	25261932
Immunoglobulin a deficiency	Immunoglobulin A deficiency (disorder)	rs72553883, rs72553882, rs144718007	27723758
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	16611307
Multiple sclerosis	Multiple Sclerosis	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	21833088

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Source
Unknown
Systemic lupus erythematosus	Systemic lupus erythematosus	GWAS
Multiple Sclerosis	Multiple Sclerosis	GWAS
Follicular lymphoma	Follicular lymphoma	GWAS
Dementia	Dementia	GWAS

Show/Hide Text Mining Associations (249)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	30942389
Achondroplasia and Swiss type agammaglobulinemia	Associate	12823285
Acute On Chronic Liver Failure	Inhibit	38111573
Adenocarcinoma of Lung	Associate	26264617, 32616892, 36922519
Adrenoleukodystrophy	Associate	29860501
Allergic Fungal Sinusitis	Associate	26047816
Alzheimer Disease	Associate	19849713
Anemia Aplastic	Associate	35579089
Anemia Aplastic	Stimulate	36334505
Arthritis Infectious	Associate	21540807, 32849606
Arthritis Juvenile	Associate	32787920
Arthritis Psoriatic	Associate	16507115
Arthritis Rheumatoid	Stimulate	11037875, 17328044
Arthritis Rheumatoid	Associate	12417058, 19384869, 19930661, 20398308, 20735866, 23661460, 26980135, 31338093, 32048307, 32228715
Ascites	Associate	10606960, 12911719
Ascites	Inhibit	28410380
Asthma	Associate	15958078, 17513529, 19852851, 26368653
Atherosclerosis	Associate	26871397, 32787365, 32821283, 34925641
Atypical Squamous Cells of the Cervix	Inhibit	16874820
Autoimmune Diseases	Associate	20398308, 23661460, 32996901, 33193306, 9824486
Behcet Syndrome	Stimulate	36333776
Berylliosis	Associate	25689051
beta Thalassemia	Associate	28503568
Blister	Associate	26293297
Brachydactyly Type D	Stimulate	28504607
Brain Diseases	Associate	40510346
Brain Neoplasms	Associate	40510346
Breast Neoplasms	Associate	37106127
Bronchiolitis Obliterans Syndrome	Associate	12166565, 17382246
Bruton type agammaglobulinemia	Associate	30147693
Carcinoma Basal Cell	Associate	9033277
Carcinoma Hepatocellular	Associate	15965645, 21674477, 23150092, 26938527, 31810126, 32377744, 37406019
Carcinoma Intraductal Noninfiltrating	Associate	26249178
Carcinoma Non Small Cell Lung	Inhibit	23760662, 31921114
Carcinoma Non Small Cell Lung	Associate	36922519
Carcinoma Renal Cell	Inhibit	10408703
Carcinoma Renal Cell	Associate	10447932, 31950034, 36854280
Carcinoma Squamous Cell	Associate	36922519
Carcinoma Transitional Cell	Associate	10209504
Cardiomyopathies	Associate	16584112, 8563121
Carotid Stenosis	Associate	40239267
Celiac Disease	Associate	34576145
Chlamydial Pneumonia	Stimulate	19046168
Colitis Ulcerative	Inhibit	24347371
Colitis Ulcerative	Stimulate	32872480
Colitis Ulcerative	Associate	33793617
Colorectal Neoplasms	Associate	26759006, 34486997, 34964155, 39456247, 9640250
Common Variable Immunodeficiency	Inhibit	10760795, 12100033
Common Variable Immunodeficiency	Associate	22454615
Coronary Artery Disease	Stimulate	20628522
Coronary Disease	Associate	19143751
Coronary Restenosis	Stimulate	25253465
Coronavirus Infections	Stimulate	24725946
COVID 19	Stimulate	33617048
COVID 19	Associate	33751722, 34075090, 35491910, 36404054
Crohn Disease	Associate	18069758, 33924264
Cryptogenic Organizing Pneumonia	Inhibit	10678620
Death	Inhibit	37614091
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	32996901
Dermatitis Atopic	Stimulate	11028864, 37700026
Dermatitis Atopic 1	Associate	11028864
Diabetes Gestational	Associate	38029485
Diabetes Mellitus	Stimulate	28454543
Diabetes Mellitus	Inhibit	29513874
Diabetes Mellitus Type 1	Stimulate	32483133
Diabetes Mellitus Type 1	Associate	33893332
Diabetes Mellitus Type 2	Stimulate	24378263
Diabetic Retinopathy	Associate	37773794
Drug Hypersensitivity	Associate	15958078, 17359392, 17513529, 37861500
Drug Related Side Effects and Adverse Reactions	Associate	33411730
Encephalitis Tick Borne	Stimulate	37261350
Endometrial Neoplasms	Associate	36199963, 37106127
Endometrial Neoplasms	Inhibit	39387602
Endometriosis	Inhibit	30276219
Eosinophilia	Associate	26047816
Epidermodysplasia Verruciformis	Associate	35202881
Epstein Barr Virus Infections	Stimulate	29155997
Esophageal Neoplasms	Associate	15052669
Gastrointestinal Neoplasms	Associate	29999557, 33788641
Gastrointestinal Stromal Tumors	Associate	32792357
Giant Cell Arteritis	Associate	31379838
Glioma	Associate	19688792
Glomerulonephritis IGA	Associate	14871408
Glomerulonephritis IGA	Stimulate	24219615
Granulomatosis with Polyangiitis	Associate	11737598, 9764612
Granulomatous Mastitis	Associate	39922144
Guillain Barre Syndrome	Associate	33751722
Hemophilia A	Associate	31194850
Hepatitis Autoimmune	Inhibit	16688797
Hepatitis C	Associate	28067225
Hereditary leiomyomatosis and renal cell cancer	Associate	10971392, 11313274
HIV Infections	Associate	10403920, 12468426, 25340508
HIV Infections	Stimulate	20847379, 33013882
HIV Infections	Inhibit	31323092, 34630420
HIV Seropositivity	Stimulate	33459349
Hodgkin Disease	Associate	10971392, 20519630
HTLV I Infections	Associate	20956799
Huntington Disease	Inhibit	30346851
Hypereosinophilic Syndrome	Associate	10449520
Hypertension Portal	Stimulate	34930041
Hypomagnesemia 5 Renal with Ocular Involvement	Stimulate	17868260
Hypoxia	Inhibit	34456926
Idiopathic Noncirrhotic Portal Hypertension	Associate	24378263, 37928515
Idiopathic Pulmonary Fibrosis	Associate	10678620
Idiopathic Pulmonary Fibrosis	Stimulate	33925174
IgA Vasculitis	Associate	10088774
Ige Responsiveness Atopic	Associate	17513529, 19852851
Immune System Diseases	Associate	15730400
Infarction	Associate	7500044
Infections	Stimulate	10559341, 11122235
Infections	Associate	23150092, 24341794
Infections	Inhibit	26649443
Inflammation	Associate	14674000, 24841635, 26735768, 26871397, 28508444, 28570862, 28904313, 29860501, 32787365, 33793617, 37918715, 39201511
Inflammation	Inhibit	22247464
Inflammation	Stimulate	37700026
Inflammatory Bowel Diseases	Associate	15762887, 37918715, 9353156
Influenza Human	Associate	27188667
Invasive Pulmonary Aspergillosis	Inhibit	40503945
Jaundice Obstructive	Associate	27252406
Keloid	Stimulate	36012134
Kidney Diseases	Associate	14871408, 21525579
Kidney Diseases	Stimulate	17868260
Kidney Failure Chronic	Inhibit	11260399
Leprosy	Associate	23283468
Leprosy	Stimulate	30389463
Leprosy Lepromatous	Inhibit	23283468
Leukemia	Stimulate	15699173
Leukemia	Associate	27708227, 27718302, 40362518
Leukemia Lymphocytic Chronic B Cell	Associate	10068672, 10812246, 12377186, 16517754, 18426971, 23154584, 25179679, 27252234, 30406401
Leukemia Lymphocytic Chronic B Cell	Stimulate	16113842
Leukemia Lymphoma Adult T Cell	Inhibit	10936095
Leukemia Lymphoma Adult T Cell	Associate	31961925, 33410215
Leukemia Monocytic Acute	Associate	26339660
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	10468608, 12902478, 36742315
Leukemia Myeloid	Associate	23175469
Leukemia Myeloid Acute	Associate	10706072, 11823047, 14662338, 15098140, 23175469, 25795133, 29720577, 30500073, 35642341, 9485189
Leukemia Myelomonocytic Acute	Associate	9485189
Leukemia Myelomonocytic Chronic	Associate	10554809
Leukemia Prolymphocytic T Cell	Associate	22010965
Leukemia T Cell	Inhibit	12648070
Leukemia T Cell	Associate	27565576
Leukemia T Cell	Stimulate	9753054
Lichen Planus	Associate	28904313
Lichen Planus Oral	Associate	28904313
Limb girdle muscular dystrophy type 2B	Stimulate	18832576
Liver Cirrhosis Biliary	Associate	26388238
Liver Failure Acute	Associate	22837127
Lung Diseases	Associate	37480005
Lung Diseases Interstitial	Associate	32996901
Lupus Erythematosus Systemic	Associate	10023862, 21250838, 22110167, 32576231, 33777025, 36180106, 36563528
Lupus Erythematosus Systemic	Stimulate	10323442, 11302879, 16879242, 17868260, 18958888, 20067533, 20478074, 29058308, 37700026
Lupus Erythematosus Systemic	Inhibit	17083624
Lyme Neuroborreliosis	Stimulate	11985531
Lymphatic Metastasis	Associate	25992611
Lymphatic Metastasis	Inhibit	26938527
Lymphoma AIDS Related	Stimulate	23722608
Lymphoma B Cell	Associate	19509224, 7742541
Lymphoma B Cell Marginal Zone	Associate	16038034, 9767448
Lymphoma Follicular	Associate	9373240
Lymphoma Large B Cell Diffuse	Associate	31600786
Lymphoma Non Hodgkin	Associate	36945359, 9546357
Lymphoma Primary Effusion	Associate	33411730
Lymphoma T Cell	Associate	26719098, 9767448
Lymphoma T Cell Cutaneous	Associate	18569641
Lymphoma T Cell Peripheral	Associate	26719098
Macrophage Activation Syndrome	Associate	26735768
Malaria	Inhibit	26902728, 27027867
Malaria	Stimulate	33617048
Malaria Cerebral	Inhibit	37060041
Melanoma	Inhibit	14727087, 24778320
Melanoma	Associate	18221542, 21903207, 37614091, 9652756
Melanoma	Stimulate	36610941
Monocyte Chemotactic Disorder	Associate	21540807
Multiple Myeloma	Associate	10029575, 10942368, 26287276, 35380688, 36796620, 39493694
Multiple Sclerosis	Stimulate	11985531, 31181776
Multiple Sclerosis	Associate	15544628, 19666086, 20526818, 24472094, 25480859, 29361022, 33766068, 35000467, 7500044, 9169496
Myelodysplastic Syndromes	Inhibit	23714180, 32179638
Myelodysplastic Syndromes	Associate	27565576
Myoclonic Epilepsies Progressive	Associate	31697809
Myopathies Structural Congenital	Associate	39531417
Nasal Polyps	Associate	36466903
Nasopharyngeal Carcinoma	Associate	17524139
Necrosis	Inhibit	12905492
Necrosis	Stimulate	16108813
Neoplasm Invasiveness	Associate	12875971
Neoplasm Metastasis	Associate	34964155, 36418844
Neoplasm Residual	Associate	26287276
Neoplasms	Associate	10594686, 10942368, 10971392, 12569387, 15693140, 15876961, 21540807, 25715123, 26938527, 29155997, 31961925, 32166404, 33968070, 34177901, 34377594 View all (9 more)
Neoplasms	Stimulate	19141400, 25314913, 27354470, 39456247
Nephritis Interstitial	Associate	11302869
Nephrotic Syndrome	Associate	31352232
Netherton Syndrome	Associate	7742541
Neuroblastoma	Associate	12771917
Obesity	Associate	28454543, 32188105
Ovarian Diseases	Associate	10606960
Ovarian Neoplasms	Associate	14715418
Ovarian Neoplasms	Stimulate	28589429
Paraparesis Tropical Spastic	Associate	10225829
Paraparesis Tropical Spastic	Stimulate	23750452, 24472094
Paraproteinemias	Associate	18245015
Peripheral Nervous System Diseases	Associate	10945811
Peritoneal Neoplasms	Associate	10606960
Persistent Mullerian duct syndrome	Associate	26719098
Personality Disorders	Stimulate	34745002
Pituitary Neoplasms	Associate	32652004, 34745002
Polycythemia Vera	Inhibit	36175590
Polysaccharide Storage of Unusual	Inhibit	20473522
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	27718302
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27708227, 40362518
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	10210778, 12580958, 12648070, 27565576, 9753054
Psoriasis	Stimulate	37700026
Pulmonary Arterial Hypertension	Associate	33604393
Pulmonary Disease Chronic Obstructive	Inhibit	16907910
Pulmonary Disease Chronic Obstructive	Stimulate	25775429, 26191210
Pulmonary Disease Chronic Obstructive	Associate	36051533
Pulpitis	Associate	33046027
Purpura Thrombocytopenic Idiopathic	Associate	16797415, 24897540, 28142207, 37660478
Recurrent respiratory papillomatosis	Stimulate	27821867
Respiratory Tract Infections	Associate	32996901
Rhinitis Allergic Seasonal	Stimulate	17359392
Sarcoidosis	Associate	17626112, 21653741, 7586698
Scleroderma Systemic	Stimulate	14729510, 15188368
Sepsis	Associate	21540807
Sepsis	Inhibit	34566996
Sialadenitis	Associate	11302869
Sjogren's Syndrome	Stimulate	10025916
Sjogren's Syndrome	Associate	11302869
Skin Diseases	Associate	9033277
Spinal Cord Diseases	Associate	24472094
Squamous Cell Carcinoma of Head and Neck	Associate	28052009, 32281488, 32548602
Squamous Cell Carcinoma of Head and Neck	Stimulate	36983005
Squamous Intraepithelial Lesions	Associate	16874820
Takayasu Arteritis	Associate	32639582
Tarlov Cysts	Associate	36418844
Telfer Sugar Jaeger syndrome	Associate	36610941
Tertiary Lymphoid Structures	Associate	32814992
Thrombocythemia Essential	Inhibit	36175590
Triple Negative Breast Neoplasms	Associate	32923150
Tuberculosis	Associate	15373915
Tuberculosis	Inhibit	17713660
Uremia	Associate	11260399
Ureteral Neoplasms	Stimulate	34862858
Urinary Bladder Neoplasms	Associate	12875971
Uterine Cervical Dysplasia	Inhibit	23521696
Uterine Cervicitis	Associate	17386046
Vaccinia	Stimulate	21411535, 33013882
Vaginosis Bacterial	Stimulate	17652029
Viremia	Stimulate	24358343
Wiskott Aldrich Syndrome	Stimulate	11745360

CD86 (CD86 molecule)