Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9402
Gene name	GRB2 related adaptor protein 2
Gene symbol	GRAP2
Synonyms (NCBI Gene)	GADSGRAP-2GRB2LGRBLGGRIDGRPLGrbXGrf40MonaP38
Chromosome	22
Chromosome location	22q13.1
Summary	This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT725476	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT725475	hsa-miR-3681-5p	HITS-CLIP	19536157
MIRT725474	hsa-miR-6849-5p	HITS-CLIP	19536157
MIRT725472	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT725473	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT725471	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT725470	hsa-miR-6765-3p	HITS-CLIP	19536157
MIRT725469	hsa-miR-4768-3p	HITS-CLIP	19536157
MIRT725467	hsa-miR-4459	HITS-CLIP	19536157
MIRT725468	hsa-miR-4433a-3p	HITS-CLIP	19536157
MIRT725466	hsa-miR-544b	HITS-CLIP	19536157
MIRT725465	hsa-miR-7162-3p	HITS-CLIP	19536157
MIRT725463	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT725464	hsa-miR-4481	HITS-CLIP	19536157
MIRT725462	hsa-miR-4745-5p	HITS-CLIP	19536157
MIRT725461	hsa-miR-3926	HITS-CLIP	19536157
MIRT725460	hsa-miR-1238-5p	HITS-CLIP	19536157
MIRT725458	hsa-miR-4758-5p	HITS-CLIP	19536157
MIRT725459	hsa-miR-548s	HITS-CLIP	19536157
MIRT640998	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT640997	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT668059	hsa-miR-4775	HITS-CLIP	23824327
MIRT657621	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT657620	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT657619	hsa-miR-1913	HITS-CLIP	23824327
MIRT657618	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT657617	hsa-miR-4313	HITS-CLIP	23824327
MIRT657616	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT640998	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT640997	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT493746	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT493745	hsa-miR-1183	PAR-CLIP	23592263
MIRT493743	hsa-miR-3925-5p	PAR-CLIP	23592263
MIRT493744	hsa-miR-3919	PAR-CLIP	23592263
MIRT493742	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT493741	hsa-miR-146a-5p	PAR-CLIP	23592263
MIRT493740	hsa-miR-146b-5p	PAR-CLIP	23592263
MIRT493739	hsa-miR-7153-5p	PAR-CLIP	23592263
MIRT493738	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT493737	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT493736	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT725476	hsa-miR-504-5p	HITS-CLIP	19536157
MIRT725475	hsa-miR-3681-5p	HITS-CLIP	19536157
MIRT725474	hsa-miR-6849-5p	HITS-CLIP	19536157
MIRT725472	hsa-miR-3620-3p	HITS-CLIP	19536157
MIRT725473	hsa-miR-3622a-3p	HITS-CLIP	19536157
MIRT725471	hsa-miR-3622b-3p	HITS-CLIP	19536157
MIRT725470	hsa-miR-6765-3p	HITS-CLIP	19536157
MIRT725469	hsa-miR-4768-3p	HITS-CLIP	19536157
MIRT725467	hsa-miR-4459	HITS-CLIP	19536157
MIRT725468	hsa-miR-4433a-3p	HITS-CLIP	19536157
MIRT725466	hsa-miR-544b	HITS-CLIP	19536157
MIRT725465	hsa-miR-7162-3p	HITS-CLIP	19536157
MIRT725463	hsa-miR-3190-5p	HITS-CLIP	19536157
MIRT725464	hsa-miR-4481	HITS-CLIP	19536157
MIRT725462	hsa-miR-4745-5p	HITS-CLIP	19536157
MIRT725461	hsa-miR-3926	HITS-CLIP	19536157
MIRT725460	hsa-miR-1238-5p	HITS-CLIP	19536157
MIRT725458	hsa-miR-4758-5p	HITS-CLIP	19536157
MIRT725459	hsa-miR-548s	HITS-CLIP	19536157
MIRT640998	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT640997	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT668059	hsa-miR-4775	HITS-CLIP	23824327
MIRT657621	hsa-miR-361-3p	HITS-CLIP	23824327
MIRT657620	hsa-miR-6752-3p	HITS-CLIP	23824327
MIRT657619	hsa-miR-1913	HITS-CLIP	23824327
MIRT657618	hsa-miR-324-3p	HITS-CLIP	23824327
MIRT657617	hsa-miR-4313	HITS-CLIP	23824327
MIRT657616	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT640998	hsa-miR-550b-3p	HITS-CLIP	23824327
MIRT640997	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT493746	hsa-miR-383-5p	PAR-CLIP	23592263
MIRT493745	hsa-miR-1183	PAR-CLIP	23592263
MIRT493743	hsa-miR-3925-5p	PAR-CLIP	23592263
MIRT493744	hsa-miR-3919	PAR-CLIP	23592263
MIRT493742	hsa-miR-4756-3p	PAR-CLIP	23592263
MIRT493741	hsa-miR-146a-5p	PAR-CLIP	23592263
MIRT493740	hsa-miR-146b-5p	PAR-CLIP	23592263
MIRT493739	hsa-miR-7153-5p	PAR-CLIP	23592263
MIRT493738	hsa-miR-1185-5p	PAR-CLIP	23592263
MIRT493737	hsa-miR-3679-5p	PAR-CLIP	23592263
MIRT493736	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT1032948	hsa-miR-3182	CLIP-seq
MIRT1032949	hsa-miR-331-3p	CLIP-seq
MIRT1032950	hsa-miR-4709-3p	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001784	Function	Phosphotyrosine residue binding	IBA
GO:0005515	Function	Protein binding	IPI	12359715, 15929943, 16189514, 16273093, 16730941, 17010654, 17065230, 17235283, 20534575, 21179510, 21516116, 24658140, 24728074, 25036101, 25241761, 25416956, 25814554, 27107012, 28514442, 29997244, 31467278, 31515488, 31980649, 32296183, 32814053, 33961781, 37398436
GO:0005634	Component	Nucleus	IDA	21179510
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21179510
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9878555
GO:0005768	Component	Endosome	IDA	21179510
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0007165	Process	Signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	TAS	9878555
GO:0007267	Process	Cell-cell signaling	TAS	9878555
GO:0043408	Process	Regulation of MAPK cascade	IBA

MIM	HGNC	e!Ensembl
604518	4563	ENSG00000100351

O75791

Protein name

GRB2-related adapter protein 2 (Adapter protein GRID) (GRB-2-like protein) (GRB2L) (GRBLG) (GRBX) (Grf40 adapter protein) (Grf-40) (Growth factor receptor-binding protein) (Hematopoietic cell-associated adapter protein GrpL) (P38) (Protein GADS) (SH3-SH2-

Protein function

Interacts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.

PDB

5GJH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	4 → 48	SH3 domain	Domain
PF00017	SH2	58 → 132	SH2 domain	Domain
PF00018	SH3_1	277 → 322	SH3 domain	Domain

Sequence

MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFH
EGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTE
KFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP
SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDIN
DGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEV
LDSSNPSWWTGRLHNKLGLFPANYVAPMTR

Sequence length

330

Interactions

View interactions

	KEGG		Reactome
	T cell receptor signaling pathway		Signaling by SCF-KIT Generation of second messenger molecules DAP12 signaling FCERI mediated MAPK activation FCERI mediated Ca+2 mobilization CD28 co-stimulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEPATITIS C	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Inhibit	36181310	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Associate	22887771	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell	Associate	26719098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma T Cell Peripheral	Associate	26719098	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	36181310, 39955062	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	32048534	★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Mullerian duct syndrome	Associate	26719098	★★★★★ ★☆☆☆☆ Found in Text Mining only

GRAP2 (GRB2 related adaptor protein 2)