Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9376
Gene name Gene Name - the full gene name approved by the HGNC.	Solute carrier family 22 member 8
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SLC22A8
Synonyms (NCBI Gene) Gene synonyms aliases	OAT3
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of t

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028886	hsa-miR-26b-5p	Microarray	19088304
MIRT1354596	hsa-miR-1207-5p	CLIP-seq
MIRT1354597	hsa-miR-3153	CLIP-seq
MIRT1354598	hsa-miR-326	CLIP-seq
MIRT1354599	hsa-miR-330-5p	CLIP-seq
MIRT1354600	hsa-miR-3616-3p	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq
MIRT1354602	hsa-miR-4661-3p	CLIP-seq
MIRT1354603	hsa-miR-4763-3p	CLIP-seq
MIRT1354604	hsa-miR-4794	CLIP-seq
MIRT1354605	hsa-miR-516b	CLIP-seq
MIRT1354606	hsa-miR-593	CLIP-seq
MIRT1354607	hsa-miR-622	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
ATF1	Unknown	16809478
CREB1	Unknown	16809478

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Inorganic anion exchanger activity	IDA	15037815
GO:0005886	Component	Plasma membrane	TAS
GO:0009636	Process	Response to toxic substance	IEA
GO:0015698	Process	Inorganic anion transport	IEA
GO:0016021	Component	Integral component of membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15037815, 27053689, 31791063
GO:0016323	Component	Basolateral plasma membrane	ISS	18619525
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417

MIM	HGNC	e!Ensembl
607581	10972	ENSG00000149452

Protein

UniProt ID

Q8TCC7

Protein name

Organic anion transporter 3 (hOAT3) (Organic anion/dicarboxylate exchanger) (Solute carrier family 22 member 8)

Protein function

Functions as an organic anion/dicarboxylate exchanger that couples organic anion uptake indirectly to the sodium gradient (PubMed:14586168, PubMed:15644426, PubMed:15846473, PubMed:16455804, PubMed:31553721). Transports organic anions such as es

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	80 → 507	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in kidney (PubMed:11306713, PubMed:11912245). Weaker expression in brain and skeletal muscle (PubMed:11306713). Expressed in adrenal glands (PubMed:15864504). {ECO:0000269|PubMed:11306713, ECO:0000269|PubMed:11912245

Sequence

MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS

Sequence length

542

Interactions

View interactions

	KEGG		Reactome
	Bile secretion Folate transport and metabolism		Organic anion transport

SLC22A8 (solute carrier family 22 member 8)