Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9376
Gene name	Solute carrier family 22 member 8
Gene symbol	SLC22A8
Synonyms (NCBI Gene)	OAT3
Chromosome	11
Chromosome location	11q12.3
Summary	This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of t

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028886	hsa-miR-26b-5p	Microarray	19088304
MIRT1354596	hsa-miR-1207-5p	CLIP-seq
MIRT1354597	hsa-miR-3153	CLIP-seq
MIRT1354598	hsa-miR-326	CLIP-seq
MIRT1354599	hsa-miR-330-5p	CLIP-seq
MIRT1354600	hsa-miR-3616-3p	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq
MIRT1354602	hsa-miR-4661-3p	CLIP-seq
MIRT1354603	hsa-miR-4763-3p	CLIP-seq
MIRT1354604	hsa-miR-4794	CLIP-seq
MIRT1354605	hsa-miR-516b	CLIP-seq
MIRT1354606	hsa-miR-593	CLIP-seq
MIRT1354607	hsa-miR-622	CLIP-seq
MIRT1354601	hsa-miR-4436b-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF1	Unknown	16809478
CREB1	Unknown	16809478

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	15037815
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186, 14675047, 22108572, 23832370, 26377792, 28534121
GO:0008514	Function	Organic anion transmembrane transporter activity	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS
GO:0009636	Process	Response to toxic substance	IEA
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015297	Function	Antiporter activity	IEA
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IDA	15037815, 27053689, 31791063
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS	18619525
GO:0016324	Component	Apical plasma membrane	IDA	31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0042908	Process	Xenobiotic transport	IEA
GO:0042910	Function	Xenobiotic transmembrane transporter activity	IDA	11669456
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417

MIM	HGNC	e!Ensembl
607581	10972	ENSG00000149452

Q8TCC7

Protein name

Organic anion transporter 3 (hOAT3) (Organic anion/dicarboxylate exchanger) (Solute carrier family 22 member 8)

Protein function

Functions as an organic anion/dicarboxylate exchanger that couples organic anion uptake indirectly to the sodium gradient (PubMed:14586168, PubMed:15644426, PubMed:15846473, PubMed:16455804, PubMed:31553721). Transports organic anions such as es

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	80 → 507	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Strongly expressed in kidney (PubMed:11306713, PubMed:11912245). Weaker expression in brain and skeletal muscle (PubMed:11306713). Expressed in adrenal glands (PubMed:15864504). {ECO:0000269|PubMed:11306713, ECO:0000269|PubMed:11912245

Sequence

MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLG
SS

Sequence length

542

Interactions

View interactions

	KEGG		Reactome
	Bile secretion Folate transport and metabolism		Organic anion transport

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Clear cell carcinoma of kidney	Likely benign	rs145474422	RCV005932997
Nonpapillary renal cell carcinoma	Likely benign	rs145474422	RCV005932996

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Carcinoma Hepatocellular	Associate	33741523
Carcinoma Renal Cell	Associate	36123895, 37657024
Chemical and Drug Induced Liver Injury	Associate	19034961
Cholestasis Extrahepatic	Associate	19034961
Diabetic Nephropathies	Inhibit	23949796
Drug Related Side Effects and Adverse Reactions	Associate	19034961
Gout	Associate	35406626
Leukemia Lymphocytic Chronic B Cell	Associate	25477469
Liver Diseases Alcoholic	Inhibit	36328481
Lymphoma	Associate	25477469
Neoplasms	Associate	36123895
Non alcoholic Fatty Liver Disease	Inhibit	36328481
Reperfusion Injury	Associate	26277839

SLC22A8 (solute carrier family 22 member 8)