Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	9370
Gene name Gene Name - the full gene name approved by the HGNC.	Adiponectin, C1Q and collagen domain containing
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ADIPOQ
Synonyms (NCBI Gene) Gene synonyms aliases	ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q27.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs876661321	G>T	Risk-factor	Upstream transcript variant

Show/Hide all(291)

miRTarBase ID	miRNA	Experiments	Reference
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blotting	33451320
MIRT733363	hsa-miR-365a-3p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733364	hsa-miR-26b-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733365	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT733366	hsa-miR-146a-5p	ELISA, Immunoprecipitaion (IP), qRT-PCR	34203452
MIRT732970	hsa-miR-9-5p	Luciferase reporter assay, Western blotting, Microarray, Immunohistochemistry (IHC)	33451320
MIRT691125	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT691124	hsa-miR-6087	HITS-CLIP	23313552
MIRT691123	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT691122	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT691121	hsa-miR-3656	HITS-CLIP	23313552
MIRT691120	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT691119	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT691118	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT691117	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT691116	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT691115	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT691114	hsa-miR-363-5p	HITS-CLIP	23313552
MIRT691113	hsa-miR-6745	HITS-CLIP	23313552
MIRT691112	hsa-miR-3165	HITS-CLIP	23313552
MIRT691111	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT691110	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT691109	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT691108	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT691107	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT691106	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT691105	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT691104	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT691103	hsa-miR-3689c	HITS-CLIP	23313552
MIRT691102	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT691101	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT691100	hsa-miR-450a-1-3p	HITS-CLIP	23313552
MIRT691099	hsa-miR-3122	HITS-CLIP	23313552
MIRT691098	hsa-miR-3913-5p	HITS-CLIP	23313552
MIRT691097	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT691096	hsa-miR-6513-5p	HITS-CLIP	23313552
MIRT768807	hsa-miR-101	CLIP-seq
MIRT768808	hsa-miR-1228	CLIP-seq
MIRT768809	hsa-miR-1244	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768811	hsa-miR-1253	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT768814	hsa-miR-1303	CLIP-seq
MIRT768815	hsa-miR-144	CLIP-seq
MIRT768816	hsa-miR-153	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768818	hsa-miR-199a-3p	CLIP-seq
MIRT768819	hsa-miR-199b-3p	CLIP-seq
MIRT768820	hsa-miR-224	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768822	hsa-miR-3119	CLIP-seq
MIRT768823	hsa-miR-3125	CLIP-seq
MIRT768824	hsa-miR-3129-5p	CLIP-seq
MIRT768825	hsa-miR-3153	CLIP-seq
MIRT768826	hsa-miR-3154	CLIP-seq
MIRT768827	hsa-miR-3173-3p	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768831	hsa-miR-3672	CLIP-seq
MIRT768832	hsa-miR-371-5p	CLIP-seq
MIRT768833	hsa-miR-371b-5p	CLIP-seq
MIRT768834	hsa-miR-3916	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768837	hsa-miR-4261	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768840	hsa-miR-4428	CLIP-seq
MIRT768841	hsa-miR-4475	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768844	hsa-miR-448	CLIP-seq
MIRT768845	hsa-miR-4484	CLIP-seq
MIRT768846	hsa-miR-4509	CLIP-seq
MIRT768847	hsa-miR-4517	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768849	hsa-miR-4534	CLIP-seq
MIRT768850	hsa-miR-4539	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768853	hsa-miR-4668-5p	CLIP-seq
MIRT768854	hsa-miR-4680-5p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768856	hsa-miR-4714-3p	CLIP-seq
MIRT768857	hsa-miR-4715-5p	CLIP-seq
MIRT768858	hsa-miR-4724-5p	CLIP-seq
MIRT768859	hsa-miR-4744	CLIP-seq
MIRT768860	hsa-miR-4777-3p	CLIP-seq
MIRT768861	hsa-miR-4793-5p	CLIP-seq
MIRT768862	hsa-miR-4797-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768867	hsa-miR-548an	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768869	hsa-miR-571	CLIP-seq
MIRT768870	hsa-miR-576-3p	CLIP-seq
MIRT768871	hsa-miR-582-5p	CLIP-seq
MIRT768872	hsa-miR-600	CLIP-seq
MIRT768873	hsa-miR-649	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768876	hsa-miR-759	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768880	hsa-miR-1226	CLIP-seq
MIRT768810	hsa-miR-1252	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768881	hsa-miR-24	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768882	hsa-miR-3185	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT768830	hsa-miR-3613-3p	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT768884	hsa-miR-3934	CLIP-seq
MIRT768885	hsa-miR-3945	CLIP-seq
MIRT768886	hsa-miR-4253	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT768888	hsa-miR-4284	CLIP-seq
MIRT768838	hsa-miR-4311	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT768842	hsa-miR-4476	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768848	hsa-miR-4533	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT768852	hsa-miR-4653-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT768892	hsa-miR-4709-3p	CLIP-seq
MIRT768893	hsa-miR-4717-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768895	hsa-miR-4733-3p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768898	hsa-miR-499-3p	CLIP-seq
MIRT768899	hsa-miR-499a-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT768902	hsa-miR-570	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768905	hsa-miR-9	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT1920217	hsa-miR-186	CLIP-seq
MIRT1920218	hsa-miR-3133	CLIP-seq
MIRT1920219	hsa-miR-3647-3p	CLIP-seq
MIRT1920220	hsa-miR-577	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT1926734	hsa-miR-3646	CLIP-seq
MIRT1926735	hsa-miR-3682-5p	CLIP-seq
MIRT1926736	hsa-miR-505	CLIP-seq
MIRT1926737	hsa-miR-606	CLIP-seq
MIRT2167691	hsa-miR-1208	CLIP-seq
MIRT768812	hsa-miR-1262	CLIP-seq
MIRT2167692	hsa-miR-1273e	CLIP-seq
MIRT768813	hsa-miR-1273f	CLIP-seq
MIRT2167693	hsa-miR-143	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT2167694	hsa-miR-187	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT2167695	hsa-miR-302f	CLIP-seq
MIRT1926733	hsa-miR-3145-5p	CLIP-seq
MIRT2167696	hsa-miR-3157-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT2167698	hsa-miR-3622b-5p	CLIP-seq
MIRT2167699	hsa-miR-3664-3p	CLIP-seq
MIRT2167700	hsa-miR-3908	CLIP-seq
MIRT768835	hsa-miR-3926	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167701	hsa-miR-3974	CLIP-seq
MIRT768887	hsa-miR-4267	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768890	hsa-miR-4433	CLIP-seq
MIRT2167704	hsa-miR-4434	CLIP-seq
MIRT2167705	hsa-miR-4457	CLIP-seq
MIRT2167706	hsa-miR-4459	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2167707	hsa-miR-4516	CLIP-seq
MIRT2167708	hsa-miR-4535	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2167709	hsa-miR-4691-3p	CLIP-seq
MIRT768855	hsa-miR-4701-3p	CLIP-seq
MIRT768891	hsa-miR-4703-3p	CLIP-seq
MIRT2167710	hsa-miR-4708-5p	CLIP-seq
MIRT768894	hsa-miR-4722-5p	CLIP-seq
MIRT768896	hsa-miR-4768-3p	CLIP-seq
MIRT2167711	hsa-miR-4770	CLIP-seq
MIRT2167712	hsa-miR-4776-5p	CLIP-seq
MIRT768897	hsa-miR-4786-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768865	hsa-miR-508-5p	CLIP-seq
MIRT2167713	hsa-miR-512-5p	CLIP-seq
MIRT2167714	hsa-miR-513b	CLIP-seq
MIRT768866	hsa-miR-542-3p	CLIP-seq
MIRT768868	hsa-miR-548s	CLIP-seq
MIRT2167715	hsa-miR-597	CLIP-seq
MIRT2167716	hsa-miR-624	CLIP-seq
MIRT768875	hsa-miR-661	CLIP-seq
MIRT768903	hsa-miR-665	CLIP-seq
MIRT2167717	hsa-miR-668	CLIP-seq
MIRT2167718	hsa-miR-711	CLIP-seq
MIRT768877	hsa-miR-766	CLIP-seq
MIRT768904	hsa-miR-890	CLIP-seq
MIRT768906	hsa-miR-940	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT768851	hsa-miR-4649-3p	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768878	hsa-miR-10a	CLIP-seq
MIRT768879	hsa-miR-10b	CLIP-seq
MIRT768817	hsa-miR-1827	CLIP-seq
MIRT768821	hsa-miR-298	CLIP-seq
MIRT768828	hsa-miR-3192	CLIP-seq
MIRT768883	hsa-miR-339-5p	CLIP-seq
MIRT768829	hsa-miR-3612	CLIP-seq
MIRT2167697	hsa-miR-3622a-5p	CLIP-seq
MIRT768836	hsa-miR-3929	CLIP-seq
MIRT2167702	hsa-miR-4281	CLIP-seq
MIRT2470376	hsa-miR-4293	CLIP-seq
MIRT768839	hsa-miR-4419b	CLIP-seq
MIRT768889	hsa-miR-4421	CLIP-seq
MIRT2167703	hsa-miR-4423-3p	CLIP-seq
MIRT768843	hsa-miR-4478	CLIP-seq
MIRT2470377	hsa-miR-4684-5p	CLIP-seq
MIRT768863	hsa-miR-485-5p	CLIP-seq
MIRT768864	hsa-miR-490-3p	CLIP-seq
MIRT768900	hsa-miR-511	CLIP-seq
MIRT768901	hsa-miR-548c-3p	CLIP-seq
MIRT2470378	hsa-miR-596	CLIP-seq
MIRT768874	hsa-miR-650	CLIP-seq

Transcription factors

Show/Hide all(4)

Transcription factor	Regulation	Reference
PPARG	Activation	20484463
PPARG	Unknown	18373719;19833717
SP1	Activation	12378384
TFAP2B	Repression	19325541

Show/Hide all(124)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	18431508
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	ISS	12368907
GO:0005125	Function	Cytokine activity	NAS	12611609
GO:0005179	Function	Hormone activity	IDA	11222466, 18703020
GO:0005179	Function	Hormone activity	IEA
GO:0005201	Function	Extracellular matrix structural constituent	RCA	28675934
GO:0005515	Function	Protein binding	IPI	12070119, 25910212, 31515488, 32296183, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005576	Component	Extracellular region	IDA	11222466
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IDA	10403784, 15585515, 17327472
GO:0005615	Component	Extracellular space	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006006	Process	Glucose metabolic process	ISS	12368907
GO:0006091	Process	Generation of precursor metabolites and energy	TAS	10095105
GO:0006635	Process	Fatty acid beta-oxidation	IEA
GO:0006635	Process	Fatty acid beta-oxidation	ISS	12368907
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0009744	Process	Response to sucrose	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009749	Process	Response to glucose	ISS	12368907
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0009967	Process	Positive regulation of signal transduction	ISS	12368907
GO:0009986	Component	Cell surface	IDA	10982546
GO:0010467	Process	Gene expression	IEA
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12070119
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IEA
GO:0010745	Process	Negative regulation of macrophage derived foam cell differentiation	IDA	11222466
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	10604883
GO:0010875	Process	Positive regulation of cholesterol efflux	IDA	18703020
GO:0010906	Process	Regulation of glucose metabolic process	IDA	17327472
GO:0014823	Process	Response to activity	IEA
GO:0019395	Process	Fatty acid oxidation	IEA
GO:0019395	Process	Fatty acid oxidation	ISS
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030336	Process	Negative regulation of cell migration	ISS
GO:0030853	Process	Negative regulation of granulocyte differentiation	IDA	10961870
GO:0031012	Component	Extracellular matrix	HDA	28675934
GO:0031667	Process	Response to nutrient levels	IEA
GO:0031953	Process	Negative regulation of protein autophosphorylation	IDA	12070119
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	10961870
GO:0032757	Process	Positive regulation of interleukin-8 production	IDA	19524870
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0033034	Process	Positive regulation of myeloid cell apoptotic process	IDA	10961870
GO:0033211	Process	Adiponectin-activated signaling pathway	IDA	18703020
GO:0033691	Function	Sialic acid binding	IDA	19855092
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IDA	10604883
GO:0034383	Process	Low-density lipoprotein particle clearance	IDA	11222466
GO:0034612	Process	Response to tumor necrosis factor	IDA	10604883
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS	12368907
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12021245
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	10982546
GO:0043407	Process	Negative regulation of MAP kinase activity	ISS
GO:0043539	Function	Protein serine/threonine kinase activator activity	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IDA	12021245
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045650	Process	Negative regulation of macrophage differentiation	IDA	10961870
GO:0045721	Process	Negative regulation of gluconeogenesis	IEA
GO:0045721	Process	Negative regulation of gluconeogenesis	ISS	12368907
GO:0045776	Process	Negative regulation of blood pressure	IDA	17327472
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18431508
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IEA
GO:0045923	Process	Positive regulation of fatty acid metabolic process	ISS	12368907
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046326	Process	Positive regulation of D-glucose import	ISS	12368907
GO:0046888	Process	Negative regulation of hormone secretion	IEA
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	11222466
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050728	Process	Negative regulation of inflammatory response	NAS	12611609
GO:0050765	Process	Negative regulation of phagocytosis	IDA	10961870
GO:0050805	Process	Negative regulation of synaptic transmission	IDA	17327472
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	ISS
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0060621	Process	Negative regulation of cholesterol import	IDA	11222466
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IDA	12070119
GO:0070543	Process	Response to linoleic acid	IEA
GO:0070994	Process	Detection of oxidative stress	IEA
GO:0070994	Process	Detection of oxidative stress	ISS
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	ISS
GO:0071639	Process	Positive regulation of monocyte chemotactic protein-1 production	IDA	19524870
GO:0071872	Process	Cellular response to epinephrine stimulus	IEA
GO:0072659	Process	Protein localization to plasma membrane	IDA	18431508
GO:0090317	Process	Negative regulation of intracellular protein transport	IDA	18431508
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24531262, 26166748
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	10982546
GO:1900121	Process	Negative regulation of receptor binding	IDA	12070119
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	12070119
GO:1904753	Process	Negative regulation of vascular associated smooth muscle cell migration	IDA	12070119
GO:2000279	Process	Negative regulation of DNA biosynthetic process	IDA	12070119
GO:2000467	Process	Positive regulation of glycogen (starch) synthase activity	ISS
GO:2000478	Process	Positive regulation of metanephric podocyte development	IEA
GO:2000478	Process	Positive regulation of metanephric podocyte development	ISS
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IDA	18431508, 19524870
GO:2000534	Process	Positive regulation of renal albumin absorption	IDA	18431508
GO:2000534	Process	Positive regulation of renal albumin absorption	IEA
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	IEA
GO:2000584	Process	Negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	IEA
GO:2000590	Process	Negative regulation of metanephric mesenchymal cell migration	ISS

MIM	HGNC	e!Ensembl
605441	13633	ENSG00000181092

Protein

UniProt ID

Q15848

Protein name

Adiponectin (30 kDa adipocyte complement-related protein) (Adipocyte complement-related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain-containing protein) (Adipose most abundant gene transcript 1 protein) (apM-1) (Gelatin-binding protein)

Protein function

Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal mus

PDB

4DOU , 6U66 , 6U6N

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01391	Collagen	37 → 108	Collagen triple helix repeat (20 copies)	Repeat
PF00386	C1q	114 → 239	C1q domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Synthesized exclusively by adipocytes and secreted into plasma. {ECO:0000269|PubMed:8947845}.

Sequence

MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN

Sequence length

244

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Hormone signaling AMPK signaling pathway Longevity regulating pathway Adipocytokine signaling pathway Type II diabetes mellitus Non-alcoholic fatty liver disease Alcoholic liver disease		AMPK inhibits chREBP transcriptional activation activity Transcriptional regulation of white adipocyte differentiation

Show/Hide Causal Diseases (1)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Adiponectin Deficiency	adiponectin deficiency	rs121917815	N/A

Show/Hide Text Mining Associations (358)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Stimulate	31377728
Abortion Habitual	Associate	29559003
Abortion Spontaneous	Associate	29559003
Acth Independent Macronodular Adrenal Hyperplasia	Inhibit	38098864
Acute Coronary Syndrome	Inhibit	16565557
Acute Coronary Syndrome	Associate	40303486
Adenocarcinoma of Lung	Inhibit	32570854
Adenoma	Associate	29802748
Adenomatous Polyps	Associate	25640382
Adrenal incidentaloma	Associate	29689708
Albuminuria	Associate	21229348
Alzheimer Disease	Stimulate	22213409, 28421328
Alzheimer Disease	Associate	25902149, 34757660, 36114174, 36527105
Amblyopia	Associate	33897209
Amniotic Band Syndrome	Associate	19591073
Angina Pectoris Variant	Inhibit	16565557
Angina Stable	Associate	40303486
Angina Unstable	Associate	31561637
Anorexia Nervosa	Associate	17705672
Anxiety	Associate	30504920, 36472110
Anxiety Disorders	Associate	36472110
Aortic Aneurysm Abdominal	Associate	22163325, 37897936
Aortic Valve Stenosis	Associate	35524481
Arteriosclerosis	Inhibit	33562295
Arthritis	Associate	16547285, 26712749
Arthritis Gouty	Associate	36994890
Arthritis Psoriatic	Inhibit	23144698
Arthritis Psoriatic	Associate	24434628
Arthritis Psoriatic	Stimulate	25196858
Arthritis Rheumatoid	Stimulate	16547285
Arthritis Rheumatoid	Associate	19883500, 20222108, 20564003, 22532632, 22767598, 29940013, 35136158, 36439145
Ascites	Associate	24259947
Asphyxia	Associate	32627013
Asthma	Associate	22837379, 26546898, 36253437
Atherosclerosis	Associate	12736161, 17332688, 17991878, 18270431, 18511057, 19165155, 19426517, 20044088, 20145358, 20395949, 20819416, 21273992, 23897791, 24330659, 25049200 View all (7 more)
Atherosclerosis	Inhibit	14675060, 16106049, 16269654, 16891099, 16926524, 17216283, 17991878, 19617629, 19667111, 20016047, 20178558, 20814418, 21219602, 21284833, 21943112 View all (18 more)
Atrial Fibrillation	Stimulate	25855796
Atrial Fibrillation	Associate	38114533
Autoimmune Diseases	Associate	23144698
Barrett Esophagus	Associate	23756394
Biliary Atresia	Associate	26884098
Biliary Tract Neoplasms	Stimulate	35384390
Bone Diseases	Associate	34948648
Bone Diseases Metabolic	Associate	30819183
Breast Neoplasms	Associate	18451143, 18827813, 20418665, 20697428, 21397927, 21516303, 21694446, 23624817, 23750285, 25923423, 26395295, 27857161, 29311755, 30883598, 32028860 View all (9 more)
Breast Neoplasms	Inhibit	19483724, 36114448
Cachexia	Associate	22881231
Carcinogenesis	Associate	19483724, 20418665, 23628382, 25370174, 30379922, 33587254, 36429712, 39379897
Carcinoma Hepatocellular	Associate	18424096, 19290887, 25300295, 35384390
Carcinoma Hepatocellular	Inhibit	24619866
Carcinoma Non Small Cell Lung	Associate	26018909, 29956809, 33155213
Carcinoma Non Small Cell Lung	Inhibit	32570854
Carcinoma Ovarian Epithelial	Associate	29603059
Carcinoma Renal Cell	Associate	25827778, 28178338, 31401413
Cardio Renal Syndrome	Associate	30816311
Cardiomegaly	Associate	36114174
Cardiomyopathies	Associate	17106732, 37804308
Cardiovascular Diseases	Associate	12694320, 16210704, 17363678, 18239552, 18299205, 18362426, 19556726, 20395949, 20418665, 20460359, 20930713, 21226932, 21617638, 21771975, 22253614 View all (19 more)
Cardiovascular Diseases	Inhibit	14675060, 18511057, 19483724, 22471989, 23339001, 30536591
Carotid Artery Diseases	Associate	17332688
Carotid Stenosis	Associate	20044088
Cartilage Diseases	Associate	16891099, 33484170
Cell Transformation Neoplastic	Associate	32053513
Cerebral Infarction	Associate	21155030, 21771975, 28245897, 32771014, 33378050
Chemical and Drug Induced Liver Injury	Associate	28744589
Chronic Disease	Associate	20443850
Chronic Periodontitis	Associate	31038568
Cognition Disorders	Associate	32020605, 35600795, 36114174
Colonic Neoplasms	Associate	33140821
Colorectal Neoplasms	Associate	18827209, 20846215, 21263187, 21299716, 21694446, 21749709, 21829206, 22087284, 22565227, 23826253, 24116229, 25022390, 25370174, 25422229, 25489716 View all (9 more)
Colorectal Neoplasms	Inhibit	21749709, 25431318, 28550647, 32210264, 32744690
Colorectal Neoplasms	Stimulate	32053666
Common Variable Immunodeficiency	Associate	31827477
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	35002951
Constriction Pathologic	Associate	18349107
Constriction Pathologic	Stimulate	28848139
Corneal dystrophy Avellino type	Inhibit	23121676
Corneal Dystrophy Fleck	Inhibit	23121676
Coronary Aneurysm	Associate	26446643
Coronary Artery Disease	Associate	15063429, 16565557, 16926524, 19661719, 19960000, 20930713, 21218266, 21226932, 21498926, 23590551, 24699314, 25880054, 26781170, 26884098, 28848139 View all (11 more)
Coronary Artery Disease	Inhibit	16739393, 20145358, 21284833, 21981776, 27352781
Coronary Artery Disease Development of in HIV	Associate	20395949
Coronary Disease	Associate	17712123, 24760538, 26400332, 26754433, 27252388, 28737466
Coronary Disease	Inhibit	21741045
Coronary Restenosis	Associate	18349107, 31389602
COVID 19	Associate	33904656
Crohn Disease	Stimulate	15888786
Crohn Disease	Associate	23121676
Cryoglobulinemia	Stimulate	35677050
Cystic Fibrosis	Associate	31582896
Cytokine Release Syndrome	Associate	29940013
Death	Associate	22196150, 25300295, 27609367, 29263167, 31412946
Death	Stimulate	23220424, 29559829
Death	Inhibit	24561578
Dementia	Stimulate	22213409
Dementia	Associate	28421328
Dental Plaque	Associate	20044088
Dermatitis Atopic	Associate	35998284
Diabetes Gestational	Inhibit	15005780, 24338462, 24349098, 25031708, 30020508, 35532201, 36709877
Diabetes Gestational	Associate	20150288, 26094529, 26842272, 28050671, 28846666, 30355290, 31978117, 32627013, 33750967, 35689735, 37524927, 37953238, 38093364, 40004118
Diabetes Mellitus	Associate	16210704, 16788799, 17224338, 17684226, 18239552, 18285554, 18776141, 19107905, 20443850, 21218266, 21409316, 22049178, 22056417, 22164267, 22443353 View all (28 more)
Diabetes Mellitus	Inhibit	16891099, 16926524, 19667111, 19672024, 20368216, 22445099, 22545589, 23283133, 25049200, 26781170, 28713075, 31533725, 38114533
Diabetes Mellitus Type 1	Associate	14675060, 18496510, 19056609, 20667095, 25942477, 27368123, 30467975
Diabetes Mellitus Type 1	Stimulate	21900154, 26382922
Diabetes Mellitus Type 2	Inhibit	11469400, 15761178, 17184146, 18448614, 18511057, 19238139, 19622782, 19797823, 20819416, 21234863, 22403302, 23339001, 24324367, 24495560, 25759378 View all (9 more)
Diabetes Mellitus Type 2	Associate	12388136, 15063429, 15830179, 16443793, 16788799, 16926524, 17216283, 17259404, 17705672, 18299205, 18429970, 18442481, 18614852, 18716158, 18719649 View all (65 more)
Diabetic Angiopathies	Associate	21397613
Diabetic Cardiomyopathies	Inhibit	26614846
Diabetic Nephropathies	Associate	18496510, 19056609, 20667095, 24894086, 27368123, 30135333, 37175838
Diabetic Retinopathy	Associate	30882695, 33374471
Disease	Associate	28848135
Disease Models Animal	Associate	22327199, 24009259
Diverticulum	Associate	24740401
Dwarfism Pituitary	Associate	20016047
Dyslipidemias	Associate	23047599, 25897955, 28315561, 30816311, 36157437
Eales disease	Associate	26884098
Embolism Fat	Associate	22327199, 25832963
Embolism Fat	Inhibit	26423718
Emphysema	Associate	23777323
Endometrial Neoplasms	Inhibit	21980131
Endometrial Neoplasms	Associate	22038736, 26386690, 29297146, 32370713
Endometriosis	Inhibit	26459399
Epiphyseal dysplasia multiple 1	Associate	24982243
Erythema elevatum diutinum	Inhibit	24982243
Esophageal Squamous Cell Carcinoma	Associate	30640413
Essential Hypertension	Associate	21637762, 23047599, 23897791, 27936341
Familial Mediterranean Fever	Associate	31377728
Fatty Liver	Associate	15591515, 22327199, 22898488, 29863454, 32053513, 35831700
Fatty Liver	Inhibit	20168312, 25132761
Fatty Liver Alcoholic	Inhibit	15591515
Fetal Distress	Associate	32627013
Fetal Growth Retardation	Associate	23836432, 38069155
Fetal Macrosomia	Associate	32627013
Fibrocartilaginous embolism	Inhibit	38048212
Fibrosis	Associate	23897791, 26884098, 29469045, 29999587, 35831700
Fibrosis	Inhibit	24982243, 26797284
Fistula	Inhibit	15888786
Gastrointestinal Neoplasms	Associate	35384390
Glomerulonephritis IGA	Stimulate	30547763
Glucose Intolerance	Associate	15919831, 16788799, 28683803, 28846711, 30239167, 31359766
Glucose Intolerance	Inhibit	16118250, 30301460
Glucose Intolerance	Stimulate	22253614
Glucose Metabolism Disorders	Associate	25929254
Glycosuria Renal	Associate	20016047
Graves Ophthalmopathy	Associate	14764816, 15886250
HAIR AN syndrome	Associate	30649347
Heart Defects Congenital	Associate	33655931
Heart Diseases	Associate	34716426, 36114174
Heart Failure	Associate	18362426, 19477358, 19797823, 22379072, 22785032, 24114971, 25961010, 26921438, 29559829
Heart Failure	Stimulate	22196150
Heart Septal Defects Ventricular	Associate	32877226
Helicobacter Infections	Associate	27241145
Hemochromatosis	Associate	25985182
Hemochromatosis	Stimulate	29913483
Hemolytic Uremic Syndrome	Inhibit	23058473
Hepatic Encephalopathy	Associate	24259947
Hepatitis C	Associate	32053513
Hepatitis C Chronic	Associate	18568135, 28267407, 32053513
HIV Infections	Associate	33750967
Hyperglycemia	Associate	20466332, 33155222, 34203452
Hyperinsulinism	Associate	18827209, 20388053
Hyperlipidemia Familial Combined	Inhibit	16106049
Hyperlipidemias	Associate	23352378
Hyperlipoproteinemias	Associate	22023374
Hypertension	Associate	16785148, 20516205, 21150884, 21558084, 21637762, 22023374, 23057719, 23897791, 24330659, 24414038, 25546819, 25894102, 26146630, 27936341, 29914579, 36094942, 36157437 View all (2 more)
Hypertension	Inhibit	20552610
Hyperthyroidism	Associate	37876543
Hypertrophy	Associate	23897791
Hypoadiponectinemia	Associate	19960000, 21150884, 23658423, 26042596, 34002823, 35126789
Hypoadiponectinemia	Inhibit	21617638
Hypoadiponectinemia	Stimulate	24796925
Hypoglycemia	Associate	19131459
Hypoxia	Inhibit	17609976, 21448846, 37759548
Hypoxia	Associate	24434628, 34954853
Hypoxia	Stimulate	29348564
Idiopathic Pulmonary Fibrosis	Inhibit	38263093
Immunoglobulin G4 Related Disease	Associate	33507936
Infections	Associate	32053513
Inflammation	Inhibit	14675060, 15591515, 16164660, 16269654, 16352667, 16926524, 19079714, 19524870, 19617629, 20414354, 20814411, 21226932, 22227293, 22253614, 22471989 View all (29 more)
Inflammation	Associate	15005780, 15888786, 16547285, 17634253, 19591073, 19883500, 20564003, 21273992, 21372608, 21824049, 22179449, 22393448, 22532632, 22549135, 22767598 View all (25 more)
Insulin Resistance	Associate	11469400, 12388136, 15005780, 16210704, 16739393, 16926524, 17030959, 17213476, 17216283, 17372314, 17684226, 17705672, 17712104, 18258617, 18429970 View all (67 more)
Insulin Resistance	Inhibit	12687327, 17488807, 18445668, 19667111, 20168312, 21229348, 21846802, 22393448, 22545589, 23283133, 24586568, 24796925, 27342408, 31359766, 31554182
Intervertebral Disc Degeneration	Associate	38048212
Intervertebral Disc Displacement	Stimulate	36740606
Intestinal Pseudo Obstruction	Associate	15547300
Intestinal Pseudo Obstruction	Inhibit	29645064
Joint Diseases	Associate	16547285, 22532632, 36740606
Keratoacanthoma	Associate	25676557
Kidney Diseases	Associate	14675060, 19056609, 19524870, 20667095, 24894086, 29207395, 31269899
Kidney Failure Chronic	Associate	12694320, 15200411, 18496510, 23283133, 25049200, 27368123
Kidney Failure Chronic	Stimulate	14675060
Leigh Disease	Associate	36549505
Leiomyoma	Associate	29348564
Leydig Cell Tumor	Associate	32455738
Lipid Metabolism Disorders	Associate	26634484
Lipodystrophy Congenital Generalized	Associate	18640396
Liver Cirrhosis	Associate	28267407, 28744589
Liver Cirrhosis Biliary	Associate	19883500, 24434628
Liver Diseases Alcoholic	Stimulate	24259947
Liver Diseases Alcoholic	Associate	29469045
Liver Failure	Associate	18719649, 24259947, 29469045, 35831700
Lung Diseases Interstitial	Inhibit	38263093
Lung Neoplasms	Inhibit	26018909
Lung Neoplasms	Associate	32570854
Lupus Erythematosus Systemic	Stimulate	16164660
Lupus Erythematosus Systemic	Associate	19524870, 19811274, 20044088, 30183598
Lupus Nephritis	Associate	25345756, 27716443
Lymphatic Metastasis	Inhibit	23181352
Lymphoma Non Hodgkin	Associate	19738128
Melanoma	Inhibit	37481560
Mental Disorders	Associate	36472110
Metabolic Diseases	Associate	18239552, 20460359, 21150884, 21218266, 23032297, 23149075, 23512866, 24330659, 24477029, 26423718, 26504811, 29237687, 32076038, 34716426, 34779349 View all (4 more)
Metabolic Diseases	Inhibit	38603890
Metabolic Syndrome	Associate	15063429, 15562250, 15919831, 16231029, 17332688, 17634253, 17684226, 18568135, 18820653, 19164335, 19238139, 19321583, 19483724, 19761474, 19887569 View all (47 more)
Metabolic Syndrome	Inhibit	17652887, 20418665, 21498926, 22489167
Metabolic Syndrome	Stimulate	38114533
Microphthalmia Syndromic 10	Associate	27981440
Microscopic Polyangiitis	Associate	34242326
Mitochondrial Diseases	Associate	35600795
Monoclonal Gammopathy of Undetermined Significance	Associate	28602036
Monosomy	Associate	32396633
Mood Disorders	Associate	30504920
Multiple Myeloma	Inhibit	28602036, 30408155, 31985020
Multiple Sclerosis	Associate	32154570, 33486671
Muscle Neoplasms	Associate	28188344
Muscular Dystrophy Duchenne	Associate	28188344
Myasthenia Gravis	Associate	35802752
Myocardial Infarction	Associate	17712123, 20528971, 20576642, 22196150, 24330659
Myocardial Infarction	Inhibit	20814418
Myocardial Ischemia	Inhibit	22196150
Myopia	Associate	36867130
Myositis Ossificans	Associate	34954853
Myotonic Dystrophy	Associate	31131096, 32544194, 33155222
Myotonic Dystrophy	Inhibit	32933141
Nasopharyngeal Carcinoma	Associate	30535454
Nasopharyngeal Carcinoma	Inhibit	36361525
Neoplasm Metastasis	Inhibit	20418665, 36361525
Neoplasm Metastasis	Associate	31659105, 32396633, 32744690
Neoplasms	Inhibit	19483724, 21299716, 22038736, 23628382, 24619866, 24969908, 26160610, 26459399, 29603059, 30678425, 33067778, 35691615, 36361525, 37481560
Neoplasms	Associate	21263187, 21397927, 21694446, 21761356, 21960694, 22038736, 22087284, 23181352, 23200412, 25022390, 25038177, 25300295, 26018909, 26386690, 26431176 View all (12 more)
Neoplasms Adipose Tissue	Associate	16421345, 16467597, 17209173, 17903300, 18776141, 19238140, 21960694, 28077136, 35436409, 35805088, 37282843, 37667937
Neoplasms Adipose Tissue	Inhibit	17224338, 19887569, 32272872
Neoplasms Squamous Cell	Associate	25408239
Nephrotic Syndrome	Stimulate	12694320
No Reflow Phenomenon	Associate	32153153
Non alcoholic Fatty Liver Disease	Associate	15591515, 18376369, 22898488, 23977033, 26042596, 26897098, 27241145, 29307798, 31659105, 35069014, 35498403, 35831700
Non alcoholic Fatty Liver Disease	Inhibit	27768254
Non Muscle Invasive Bladder Neoplasms	Associate	33465047
Obesity	Inhibit	11469400, 15562250, 15761179, 16118250, 17184146, 18511057, 19672024, 20150288, 20825686, 21150884, 21273999, 21397613, 21558084, 22319581, 22545589 View all (16 more)
Obesity	Associate	15547300, 15830179, 16210704, 16421345, 16443793, 16648605, 16926524, 17030959, 17224338, 17332688, 17495197, 17684226, 17705672, 18719649, 18827209 View all (125 more)
Obesity Abdominal	Associate	15547300, 17209173, 18568135, 20460359, 26504811, 29645064
Obesity Abdominal	Inhibit	19887569, 23903497, 31608050
Obesity Maternal	Associate	30732639
Obesity Metabolically Benign	Associate	37853077
Obesity Morbid	Associate	28947843, 29645064
Obesity Morbid	Inhibit	32545403, 37266430
Obstetric Labor Premature	Associate	19591073
Ossification Heterotopic	Associate	34954853
Osteoarthritis	Associate	16891099, 21194467, 24462671, 24667577, 32095874, 33484170
Osteoarthritis Knee	Associate	30777928, 39313801
Osteoporosis	Inhibit	18511746
Osteoporosis	Associate	34948648
Osteoporotic Fractures	Associate	35461346
Osteosarcoma	Associate	31690262
Ovarian Diseases	Associate	23579009
Ovarian Neoplasms	Associate	29603059, 33921111
Overweight	Associate	17030959, 19131459, 21357378, 22023374, 24338462, 25759378, 25827778, 28060790, 28453464, 28602036, 30746959, 30816311, 31008949, 31661820, 31978107, 32398726, 34716426 View all (2 more)
Overweight	Stimulate	37149591
Pancreatic Neoplasms	Associate	19051043, 21357378, 25408239, 25516658, 30038429, 30678425, 37555827
Paragangliomas 3	Associate	32396633
Pelvic Organ Prolapse	Associate	37266648
Periodontitis	Associate	33616153
Peripheral Arterial Disease	Inhibit	23819115
Peripheral Arterial Disease	Associate	23819115
Peripheral Nervous System Diseases	Associate	36741233
Personality Disorders	Associate	25038177
Pheochromocytoma	Associate	19672024
Plaque Atherosclerotic	Inhibit	27771154
Pneumonia Lipid	Associate	18258617, 30208589
Polycystic Ovary Syndrome	Associate	16335909, 19544118, 19700156, 20388053, 21082232, 24502610, 24559720, 26631404, 28060790, 29156452, 31242787, 31382403, 32283997, 33228780, 33750349, 33914321, 35689735, 39692030 View all (3 more)
Polycystic Ovary Syndrome	Inhibit	23118428, 25423261, 25446648, 31814467, 35409282
Prader Willi Syndrome	Associate	16231029, 17666087
Pre Eclampsia	Associate	17505945, 22234370, 25879409
Prediabetic State	Associate	19107905, 30360393
Pregnancy Complications	Associate	20150288, 26634484, 26884098
Prehypertension	Associate	20552610
Prostate Cancer Hereditary 7	Associate	26320190
Prostatic Neoplasms	Associate	19035456, 21397927, 21960694, 25038177, 26160610, 26320190, 28453464
Prostatitis	Associate	20697428, 21960694, 25038177
Protein Energy Malnutrition	Associate	38017491
Proteinuria	Associate	12694320, 16164660
Proteinuria	Stimulate	30547763
Psoriasis	Associate	21681565, 33416099
Psoriasis	Inhibit	24851032
Pulmonary Arterial Hypertension	Associate	24114971, 36157437, 40073405
Pulmonary Arterial Hypertension	Stimulate	32877226
Pulmonary Disease Chronic Obstructive	Associate	22881231, 22927754, 23209832, 26806298, 30338815
Renal Artery Obstruction	Associate	35259553
Renal cell carcinoma 1	Stimulate	22948153
Renal Insufficiency	Associate	18160586
Renal Insufficiency Chronic	Associate	17363678, 22471989, 23058473, 27368123, 34035377, 37175838, 38017491
Renal Insufficiency Chronic	Stimulate	25049200
Reproductive Tract Infections	Associate	34784930
Respiratory Distress Syndrome	Associate	24586568
Respiratory Insufficiency	Inhibit	33904656
Respiratory Tract Infections	Associate	32567428
Retinal Vein Occlusion	Associate	25978399
Sarcopenia	Associate	40162588
Scleroderma Systemic	Inhibit	31667578
Sepsis	Inhibit	25580089
Sjogren's Syndrome	Associate	20112400
Sleep Apnea Obstructive	Associate	15761179, 31008949, 33378050, 38172514
Sleep Apnea Obstructive	Inhibit	19090328
Sleep Apnea Syndromes	Associate	15761179, 19090328, 31008949
Sleep Initiation and Maintenance Disorders	Inhibit	17363678
Smoke Inhalation Injury	Associate	21617638, 28737466
Soft Tissue Injuries	Associate	27357093
Spinal Cord Injuries	Associate	29559683
Squamous Cell Carcinoma of Head and Neck	Associate	23181352
ST Elevation Myocardial Infarction	Inhibit	39513871
Status Asthmaticus	Inhibit	37149591
Stiff Skin Syndrome	Stimulate	22676459
Stiff Skin Syndrome	Associate	23047599, 25894102, 27936341
Stomach Neoplasms	Inhibit	22078265, 35384390
Stomach Neoplasms	Associate	35691615
Stroke	Associate	21155030, 23047599, 31412946
Symphalangism C. S. Lewis Type	Associate	23040831
Symptom Flare Up	Stimulate	16164660
Synovitis	Associate	19883500, 20222108, 24434628
Tendinopathy	Associate	24324367, 29385715
Tertiary Lymphoid Structures	Associate	30678425
Thinness	Associate	22881231, 33897209
Thymoma	Associate	35802752
Thyroid Cancer Papillary	Inhibit	21937620, 33587254
Thyroid Neoplasms	Inhibit	21937620, 33587254
Tobacco Use Disorder	Associate	36472110
Tooth Loss	Associate	36602131
Triple Negative Breast Neoplasms	Associate	35964108
Triple Negative Breast Neoplasms	Inhibit	36114448
Tuberculosis Pulmonary	Associate	30182920
Uremia	Associate	23058473, 25049200
Urinary Bladder Neoplasms	Associate	34329197, 36218131
Uveal melanoma	Associate	32396633
Vascular Calcification	Inhibit	29718962
Vascular Calcification	Associate	31945100
Vascular Diseases	Associate	12694320, 16855192, 18496510, 21397613, 25448795, 30572569, 30920415
Vascular Diseases	Inhibit	31667578
Vascular System Injuries	Inhibit	20016047
Vascular System Injuries	Associate	20814418
Ventricular Dysfunction Left	Associate	16648605
Ventricular Dysfunction Left	Stimulate	31533725
Virus Diseases	Associate	29194580
Vitamin B 12 Deficiency	Associate	38140305
Weight Gain	Associate	16443793, 20035337, 22049178
Weight Gain	Stimulate	26374448
Weight Loss	Stimulate	12736161, 17372314, 18356846, 21846802, 23378611, 24634403, 28797697
Weight Loss	Associate	24141897, 31547312, 31747677, 33620233, 35049001, 37667937
Wolfram Like Syndrome Autosomal Dominant	Inhibit	22253614

ADIPOQ (adiponectin, C1Q and collagen domain containing)