RAB33A (RAB33A, member RAS oncogene family)

Gene

• Entrez ID: 9363
• Gene name: RAB33A, member RAS oncogene family
• Gene symbol: RAB33A
• Synonyms (NCBI Gene): RabS10
• Chromosome: X
• Chromosome location: Xq26.1
• Summary: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport. [provided by RefSeq, Jul 2008]

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000139	Component	Golgi membrane	TAS
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	7688322
GO:0005515	Function	Protein binding	IPI	16189514, 19060904, 23088713, 25416956, 32296183, 33961781
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005768	Component	Endosome	IBA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019882	Process	Antigen processing and presentation	IMP	19717423
GO:0032482	Process	Rab protein signal transduction	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 300333
• HGNC: 9773
• e!Ensembl: ENSG00000134594

Protein

• UniProt ID: Q14088
• Protein name: Ras-related protein Rab-33A (EC 3.6.5.2) (Small GTP-binding protein S10)
• Protein function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes (By similarity). Rabs cycle between an inactive GDP-bound form and an active GTP-bound form t
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	38 → 204	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed only in lymphoid cell lines. {ECO:0000269|PubMed:7688322}.
• Sequence:

  MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGT
  FPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVT
  KMTSFTNLKMWIQECNGHAVPPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFET
  SAKDPKESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSCPC

• Sequence length: 237

Pathways

Reactome:

TBC/RABGAPs
RAB geranylgeranylation