LONP1 (lon peptidase 1, mitochondrial)

Gene
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9361
Gene name Gene Name - the full gene name approved by the HGNC.
Lon peptidase 1, mitochondrial
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LONP1
Synonyms (NCBI Gene) Gene synonyms aliases
CODASS, LON, LONP, LonHS, PIM1, PRSS15, hLON
Disease Acronyms (UniProt) Disease acronyms from UniProt database
CODASS
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a mitochondrial matrix protein that belongs to the Lon family of ATP-dependent proteases. This protein mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides in the mitochondrial matrix. It may a
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(10)
SNP ID Visualize variation Clinical significance Consequence
rs730880293 T>C Pathogenic Genic downstream transcript variant, coding sequence variant, non coding transcript variant, missense variant
rs745742429 C>A,T Likely-pathogenic Stop gained, coding sequence variant, non coding transcript variant, missense variant
rs879255247 G>A Pathogenic Missense variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant
rs879255248 G>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant
rs879255249 G>A Pathogenic Missense variant, coding sequence variant, non coding transcript variant, genic downstream transcript variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
miRTarBase ID miRNA Experiments Reference
MIRT029135 hsa-miR-26b-5p Microarray 19088304
MIRT051178 hsa-miR-16-5p CLASH 23622248
MIRT038977 hsa-miR-20a-3p CLASH 23622248
MIRT1114563 hsa-miR-3654 CLIP-seq
MIRT1114564 hsa-miR-558 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(37)
GO ID Ontology Definition Evidence Reference
GO:0000002 Process Mitochondrial genome maintenance NAS 17420247
GO:0001018 Function Mitochondrial promoter sequence-specific DNA binding IDA 9485316
GO:0001018 Function Mitochondrial promoter sequence-specific DNA binding IDA 9485316
GO:0001666 Process Response to hypoxia IEP 17418790
GO:0003697 Function Single-stranded DNA binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
605490 9479 ENSG00000196365
Protein
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P36776
Protein name Lon protease homolog, mitochondrial (EC 3.4.21.53) (LONHs) (Lon protease-like protein) (LONP) (Mitochondrial ATP-dependent protease Lon) (Serine protease 15)
Protein function ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix (PubMed:12198491, PubMed:15870080,
PDB 2X36 , 6WYS , 6WZV , 6X1M , 6X27 , 7KRZ , 7KSL , 7KSM , 7NFY , 7NG4 , 7NG5 , 7NGC , 7NGF , 7NGL , 7NGP , 7NGQ , 7OXO , 7P09 , 7P0B , 7P0M , 8OJL , 8OKA , 8OM7 , 8OVF , 8OVG , 9CC0 , 9CC3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02190 LON_substr_bdg 123 → 368 ATP-dependent protease La (LON) substrate-binding domain Family
PF00004 AAA 519 → 661 ATPase family associated with various cellular activities (AAA) Domain
PF05362 Lon_C 736 → 949 Lon protease (S16) C-terminal proteolytic domain Domain
Tissue specificity TISSUE SPECIFICITY: Duodenum, heart, lung and liver, but not thymus. {ECO:0000269|PubMed:8248235}.
Sequence 
MAASTGYVRLWGAARCWVLRRPMLAAAGGRVPTAAGAWLLRGQRTCDASPPWALWGRGPA
IGGQWRGFWEASSRGGGAFSGGEDASEGGAEEGAGGAGGSAGAGEGPVITALTPMTIPDV
FPHLPLIAITRNPVFPRFIKIIEVKNKKLVELLRRKVRLAQPYVGVFLKRDDSNESDVVE
SLDEIYHTGTFAQIHEMQDLGDKLRMIVMGHRRVHISRQLEVEPEEPEAENKHKPRRKSK
RGKKEAEDELSARHPAELAMEPTPELPAEVLMVEVENVVHEDFQVTEEVKALTAEIVKTI
RDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEETNIPKRLY
KALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEK
FRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDL
ARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGPPGVGKTSIARSIARAL
NREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQ
GDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSG
YVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVL
RKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGSTLFV
ETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHI
HLHVPEGATPKDGPSAGCTIVTALLSLAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTI
AAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALAVER
Sequence length 959
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (14)
Causal
Disease term Disease name dbSNP ID References
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Brachydactyly Brachydactyly rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852
View all (22 more)
Cataract Cataract rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322
View all (150 more)
Codas syndrome CODAS syndrome rs730880293, rs879255248, rs879255249, rs1599439595 25574826, 30304514, 25808063, 1887855, 28148925
Show/Hide Unknown Diseases (5)
Unknown
Disease term Disease name Evidence References Source
Ptosis Blepharoptosis, Ptosis ClinVar
Leigh Syndrome Leigh syndrome GenCC
Mitochondrial encephalomyopathy mitochondrial encephalomyopathy GenCC
Pyruvate Dehydrogenase Deficiency pyruvate dehydrogenase E1-alpha deficiency GenCC
Show/Hide Text Mining Associations (49)
Associations from Text Mining
Disease Name Relationship Type References
Abnormalities Drug Induced Associate 29518248
Acidosis Lactic Associate 29518248
Alzheimer Disease Associate 35699875
Brain Diseases Associate 31923470
Carcinogenesis Associate 23788038
Carcinoma Non Small Cell Lung Associate 21077998
Cataract Associate 26622071, 37511188
Cerebellar Diseases Associate 30304514
Cerebral Small Vessel Diseases Associate 35699875
Chemical and Drug Induced Liver Injury Associate 37647804