EGFEM1P (EGF like and EMI domain containing 1, pseudogene)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 93556
Gene name EGF like and EMI domain containing 1, pseudogene
Gene symbol EGFEM1P
Synonyms (NCBI Gene)
C3orf50NCRNA00259
Chromosome 3
Chromosome location 3q26.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Gene Gene ontology Other IDs Protein
Show/Hide all (2)
GO ID Ontology Definition Evidence Reference
GO:0005044 Function Scavenger receptor activity IEA
GO:0016192 Process Vesicle-mediated transport IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
HGNC 25149 N/A
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q0D2K5
Protein name Putative EGF-like and EMI domain-containing protein 1
Family and domains
Sequence 
MDELRWYHITVCLDHIFGHNCSLSCKDCMNGGKCQEGKSECSCPAGCRVILCNENCLEGA
YGAGCTSECQCVEENTLECSAKNGSCTCKSGYQGNRCQKDGLWGPEGWFSSAPCENGGQC
NKKTGNCDCTPDYTRKSCTILRCISLTNLALSRRSSPMKYQQNVSSHREVRQRQQCSSDR
PFKKLLCKFSFKIGM
Sequence length 195
Interactions View interactions