Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9355
Gene name Gene Name - the full gene name approved by the HGNC.
LIM homeobox 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
LHX2
Synonyms (NCBI Gene) Gene synonyms aliases
LH2, hLhx2
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9q33.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator. The protein can recapitulate or rescue phe
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022169 hsa-miR-124-3p Microarray 18668037
MIRT042689 hsa-miR-196b-5p CLASH 23622248
MIRT734416 hsa-miR-1238-3p Immunohistochemistry (IHC), Luciferase reporter assay, Microarray, qRT-PCR, Western blotting 32526477
MIRT735618 hsa-miR-409-3p Immunohistochemistry (IHC), qRT-PCR 32040954
MIRT735620 hsa-miR-409-5p Immunohistochemistry (IHC), qRT-PCR 32040954
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603759 6594 ENSG00000106689
Protein
UniProt ID P50458
Protein name LIM/homeobox protein Lhx2 (Homeobox protein LH-2) (LIM homeobox protein 2)
Protein function Acts as a transcriptional activator. Stimulates the promoter of the alpha-glycoprotein gene. Transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types (By similarity). {ECO:00
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 53 110 LIM domain Domain
PF00412 LIM 115 172 LIM domain Domain
PF00046 Homeodomain 267 323 Homeodomain Domain
Sequence
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRF
SVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEAL
LQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRR
NLLRQENTGVDKSTDAALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF
Sequence length 406
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Neurodevelopmental Disorders complex neurodevelopmental disorder N/A N/A GenCC
Polycystic Ovary Syndrome Polycystic ovary syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anophthalmos Associate 21203406
Arthritis Rheumatoid Associate 23456299
Astrocytoma Associate 26497896
Autism Spectrum Disorder Associate 37057675
Breast Neoplasms Associate 26510686
Carcinogenesis Associate 31724536
Carcinoma Non Small Cell Lung Associate 26189214
Colorectal Neoplasms Associate 38092774
Esophageal Squamous Cell Carcinoma Associate 36011368
Familial schizencephaly Associate 20949537