Gene Gene information from NCBI Gene database.
Entrez ID 9351
Gene name NHERF family PDZ scaffold protein 2
Gene symbol NHERF2
Synonyms (NCBI Gene)
E3KARPNHE3RF2NHERF-2OCTS2SIP-1SIP1SLC9A3R2TKA-1
Chromosome 16
Chromosome location 16p13.3
miRNA miRNA information provided by mirtarbase database.
296
miRTarBase ID miRNA Experiments Reference
MIRT005146 hsa-miR-30a-5p pSILAC 18668040
MIRT005146 hsa-miR-30a-5p pSILAC 18668040
MIRT020575 hsa-miR-155-5p Proteomics 18668040
MIRT005146 hsa-miR-30a-5p Proteomics;Other 18668040
MIRT045974 hsa-miR-125b-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding IBA
GO:0005102 Function Signaling receptor binding IPI 16456542
GO:0005515 Function Protein binding IPI 9054412, 11285285, 11786550, 12369822, 12444019, 15523054, 16166090, 16203867, 16456542, 16615918, 17110338, 17242191, 17979986, 19027007, 19555689, 20618342, 22587461, 24255178, 25519916, 26618866, 27018634, 27173435, 28360110, 31324722, 32296183, 33961781, 35271311, 36012204
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus TAS 9054412
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606553 11076 ENSG00000065054
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15599
Protein name Na(+)/H(+) exchange regulatory cofactor NHE-RF2 (NHERF-2) (NHE3 kinase A regulatory protein E3KARP) (SRY-interacting protein 1) (SIP-1) (Sodium-hydrogen exchanger regulatory factor 2) (Solute carrier family 9 isoform A3 regulatory factor 2) (Tyrosine kina
Protein function Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for cAMP-mediated phosphorylatio
PDB 2D11 , 2HE4 , 2OCS , 4P0C
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 12 88 PDZ domain Domain
PF00595 PDZ 151 228 PDZ domain Domain
PF09007 EBP50_C 232 278 EBP50, C-terminal Domain
PF09007 EBP50_C 261 337 EBP50, C-terminal Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:9054412, ECO:0000269|PubMed:9096337}.
Sequence
MAAPEPLRPRLCRLVRGEQGYGFHLHGEKGRRGQFIRRVEPGSPAEAAALRAGDRLVEVN
GVNVEGETHHQVVQRIKAVEGQTRLLVV
DQETDEELRRRQLTCTEEMAQRGLPPAHDPWE
PKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLHSDKSRPGQYIRSVD
PGSPAARSGLRAQDRLIEVNGQNVEGLRHAEVVASIKAREDEARLLVV
DPETDEHFKRLR
VTPTEEHVEGPLPSPVTNGT
SPAQLNGGSACSSRSDLPGSDKDTEDGSAWKQDPFQESGL
HLSPTAAEAKEKARAMRVNKRAPQMDWNRKREIFSNF
Sequence length 337
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  Aldosterone-regulated sodium reabsorption