Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	9344
Gene name	TAO kinase 2
Gene symbol	TAOK2
Synonyms (NCBI Gene)	MAP3K17PSKPSK1PSK1-BETATAO1TAO2Tao2beta
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes a serine/threonine protein kinase that is involved in many different processes, including, cell signaling, microtubule organization and stability, and apoptosis. Alternatively spliced transcript variants encoding different isoforms have

221

Show/Hide all (221)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016093	hsa-miR-769-5p	Sequencing	20371350
MIRT049049	hsa-miR-92a-3p	CLASH	23622248
MIRT043319	hsa-miR-331-3p	CLASH	23622248
MIRT042035	hsa-miR-484	CLASH	23622248
MIRT1410963	hsa-miR-106a	CLIP-seq
MIRT1410964	hsa-miR-106b	CLIP-seq
MIRT1410965	hsa-miR-1289	CLIP-seq
MIRT1410966	hsa-miR-142-5p	CLIP-seq
MIRT1410967	hsa-miR-1587	CLIP-seq
MIRT1410968	hsa-miR-17	CLIP-seq
MIRT1410969	hsa-miR-20a	CLIP-seq
MIRT1410970	hsa-miR-20b	CLIP-seq
MIRT1410971	hsa-miR-2861	CLIP-seq
MIRT1410972	hsa-miR-302a	CLIP-seq
MIRT1410973	hsa-miR-302b	CLIP-seq
MIRT1410974	hsa-miR-302c	CLIP-seq
MIRT1410975	hsa-miR-302d	CLIP-seq
MIRT1410976	hsa-miR-302e	CLIP-seq
MIRT1410977	hsa-miR-3135b	CLIP-seq
MIRT1410978	hsa-miR-3150b-3p	CLIP-seq
MIRT1410979	hsa-miR-3198	CLIP-seq
MIRT1410980	hsa-miR-3199	CLIP-seq
MIRT1410981	hsa-miR-3202	CLIP-seq
MIRT1410982	hsa-miR-339-3p	CLIP-seq
MIRT1410983	hsa-miR-3609	CLIP-seq
MIRT1410984	hsa-miR-3652	CLIP-seq
MIRT1410985	hsa-miR-3677-3p	CLIP-seq
MIRT1410986	hsa-miR-372	CLIP-seq
MIRT1410987	hsa-miR-373	CLIP-seq
MIRT1410988	hsa-miR-3942-5p	CLIP-seq
MIRT1410989	hsa-miR-4278	CLIP-seq
MIRT1410990	hsa-miR-4294	CLIP-seq
MIRT1410991	hsa-miR-4309	CLIP-seq
MIRT1410992	hsa-miR-4420	CLIP-seq
MIRT1410993	hsa-miR-4421	CLIP-seq
MIRT1410994	hsa-miR-4430	CLIP-seq
MIRT1410995	hsa-miR-4434	CLIP-seq
MIRT1410996	hsa-miR-4440	CLIP-seq
MIRT1410997	hsa-miR-4446-3p	CLIP-seq
MIRT1410998	hsa-miR-4492	CLIP-seq
MIRT1410999	hsa-miR-4498	CLIP-seq
MIRT1411000	hsa-miR-4505	CLIP-seq
MIRT1411001	hsa-miR-4515	CLIP-seq
MIRT1411002	hsa-miR-4516	CLIP-seq
MIRT1411003	hsa-miR-4531	CLIP-seq
MIRT1411004	hsa-miR-4533	CLIP-seq
MIRT1411005	hsa-miR-4656	CLIP-seq
MIRT1411006	hsa-miR-4671-5p	CLIP-seq
MIRT1411007	hsa-miR-4674	CLIP-seq
MIRT1411008	hsa-miR-4675	CLIP-seq
MIRT1411009	hsa-miR-4689	CLIP-seq
MIRT1411010	hsa-miR-4695-5p	CLIP-seq
MIRT1411011	hsa-miR-4703-5p	CLIP-seq
MIRT1411012	hsa-miR-4741	CLIP-seq
MIRT1411013	hsa-miR-4768-3p	CLIP-seq
MIRT1411014	hsa-miR-4777-5p	CLIP-seq
MIRT1411015	hsa-miR-4784	CLIP-seq
MIRT1411016	hsa-miR-4785	CLIP-seq
MIRT1411017	hsa-miR-4796-3p	CLIP-seq
MIRT1411018	hsa-miR-4797-5p	CLIP-seq
MIRT1411019	hsa-miR-485-5p	CLIP-seq
MIRT1411020	hsa-miR-518d-5p	CLIP-seq
MIRT1411021	hsa-miR-519b-5p	CLIP-seq
MIRT1411022	hsa-miR-519c-5p	CLIP-seq
MIRT1411023	hsa-miR-519d	CLIP-seq
MIRT1411024	hsa-miR-520a-3p	CLIP-seq
MIRT1411025	hsa-miR-520b	CLIP-seq
MIRT1411026	hsa-miR-520c-3p	CLIP-seq
MIRT1411027	hsa-miR-520c-5p	CLIP-seq
MIRT1411028	hsa-miR-520d-3p	CLIP-seq
MIRT1411029	hsa-miR-520e	CLIP-seq
MIRT1411030	hsa-miR-526a	CLIP-seq
MIRT1411031	hsa-miR-548ah	CLIP-seq
MIRT1411032	hsa-miR-555	CLIP-seq
MIRT1411033	hsa-miR-577	CLIP-seq
MIRT1411034	hsa-miR-661	CLIP-seq
MIRT1411035	hsa-miR-665	CLIP-seq
MIRT1411036	hsa-miR-759	CLIP-seq
MIRT1411037	hsa-miR-762	CLIP-seq
MIRT1411038	hsa-miR-765	CLIP-seq
MIRT1411039	hsa-miR-93	CLIP-seq
MIRT2123418	hsa-miR-1185	CLIP-seq
MIRT2123419	hsa-miR-1255a	CLIP-seq
MIRT2123420	hsa-miR-1255b	CLIP-seq
MIRT1410966	hsa-miR-142-5p	CLIP-seq
MIRT2123421	hsa-miR-3120-3p	CLIP-seq
MIRT1410981	hsa-miR-3202	CLIP-seq
MIRT1410982	hsa-miR-339-3p	CLIP-seq
MIRT2123422	hsa-miR-3605-5p	CLIP-seq
MIRT2123423	hsa-miR-3663-3p	CLIP-seq
MIRT1410985	hsa-miR-3677-3p	CLIP-seq
MIRT2123424	hsa-miR-3679-5p	CLIP-seq
MIRT1410992	hsa-miR-4420	CLIP-seq
MIRT1410996	hsa-miR-4440	CLIP-seq
MIRT1411004	hsa-miR-4533	CLIP-seq
MIRT2123425	hsa-miR-4710	CLIP-seq
MIRT2123426	hsa-miR-4767	CLIP-seq
MIRT1411013	hsa-miR-4768-3p	CLIP-seq
MIRT1411016	hsa-miR-4785	CLIP-seq
MIRT1411018	hsa-miR-4797-5p	CLIP-seq
MIRT1411033	hsa-miR-577	CLIP-seq
MIRT1411035	hsa-miR-665	CLIP-seq
MIRT1411036	hsa-miR-759	CLIP-seq
MIRT1410963	hsa-miR-106a	CLIP-seq
MIRT1410964	hsa-miR-106b	CLIP-seq
MIRT2123418	hsa-miR-1185	CLIP-seq
MIRT2345460	hsa-miR-1287	CLIP-seq
MIRT2345461	hsa-miR-134	CLIP-seq
MIRT1410966	hsa-miR-142-5p	CLIP-seq
MIRT1410968	hsa-miR-17	CLIP-seq
MIRT1410969	hsa-miR-20a	CLIP-seq
MIRT1410970	hsa-miR-20b	CLIP-seq
MIRT1410971	hsa-miR-2861	CLIP-seq
MIRT1410972	hsa-miR-302a	CLIP-seq
MIRT1410973	hsa-miR-302b	CLIP-seq
MIRT1410974	hsa-miR-302c	CLIP-seq
MIRT1410975	hsa-miR-302d	CLIP-seq
MIRT1410976	hsa-miR-302e	CLIP-seq
MIRT2345462	hsa-miR-3118	CLIP-seq
MIRT1410977	hsa-miR-3135b	CLIP-seq
MIRT2345463	hsa-miR-3145-3p	CLIP-seq
MIRT1410978	hsa-miR-3150b-3p	CLIP-seq
MIRT1410980	hsa-miR-3199	CLIP-seq
MIRT1410981	hsa-miR-3202	CLIP-seq
MIRT1410982	hsa-miR-339-3p	CLIP-seq
MIRT2123422	hsa-miR-3605-5p	CLIP-seq
MIRT1410983	hsa-miR-3609	CLIP-seq
MIRT1410985	hsa-miR-3677-3p	CLIP-seq
MIRT2123424	hsa-miR-3679-5p	CLIP-seq
MIRT1410986	hsa-miR-372	CLIP-seq
MIRT1410987	hsa-miR-373	CLIP-seq
MIRT2345464	hsa-miR-378	CLIP-seq
MIRT2345465	hsa-miR-378b	CLIP-seq
MIRT2345466	hsa-miR-378c	CLIP-seq
MIRT2345467	hsa-miR-378d	CLIP-seq
MIRT2345468	hsa-miR-378e	CLIP-seq
MIRT2345469	hsa-miR-378f	CLIP-seq
MIRT2345470	hsa-miR-378h	CLIP-seq
MIRT2345471	hsa-miR-378i	CLIP-seq
MIRT2345472	hsa-miR-422a	CLIP-seq
MIRT2345473	hsa-miR-4330	CLIP-seq
MIRT1410992	hsa-miR-4420	CLIP-seq
MIRT1410993	hsa-miR-4421	CLIP-seq
MIRT1410995	hsa-miR-4434	CLIP-seq
MIRT1410996	hsa-miR-4440	CLIP-seq
MIRT1410997	hsa-miR-4446-3p	CLIP-seq
MIRT1410998	hsa-miR-4492	CLIP-seq
MIRT1410999	hsa-miR-4498	CLIP-seq
MIRT1411000	hsa-miR-4505	CLIP-seq
MIRT1411001	hsa-miR-4515	CLIP-seq
MIRT1411002	hsa-miR-4516	CLIP-seq
MIRT1411003	hsa-miR-4531	CLIP-seq
MIRT1411004	hsa-miR-4533	CLIP-seq
MIRT1411006	hsa-miR-4671-5p	CLIP-seq
MIRT1411009	hsa-miR-4689	CLIP-seq
MIRT1411010	hsa-miR-4695-5p	CLIP-seq
MIRT2123425	hsa-miR-4710	CLIP-seq
MIRT1411013	hsa-miR-4768-3p	CLIP-seq
MIRT1411014	hsa-miR-4777-5p	CLIP-seq
MIRT1411015	hsa-miR-4784	CLIP-seq
MIRT1411016	hsa-miR-4785	CLIP-seq
MIRT1411017	hsa-miR-4796-3p	CLIP-seq
MIRT1411018	hsa-miR-4797-5p	CLIP-seq
MIRT1411019	hsa-miR-485-5p	CLIP-seq
MIRT2345474	hsa-miR-511	CLIP-seq
MIRT1411020	hsa-miR-518d-5p	CLIP-seq
MIRT1411021	hsa-miR-519b-5p	CLIP-seq
MIRT1411022	hsa-miR-519c-5p	CLIP-seq
MIRT1411023	hsa-miR-519d	CLIP-seq
MIRT1411024	hsa-miR-520a-3p	CLIP-seq
MIRT1411025	hsa-miR-520b	CLIP-seq
MIRT1411026	hsa-miR-520c-3p	CLIP-seq
MIRT1411027	hsa-miR-520c-5p	CLIP-seq
MIRT1411028	hsa-miR-520d-3p	CLIP-seq
MIRT1411029	hsa-miR-520e	CLIP-seq
MIRT1411030	hsa-miR-526a	CLIP-seq
MIRT1411031	hsa-miR-548ah	CLIP-seq
MIRT2345475	hsa-miR-572	CLIP-seq
MIRT1411033	hsa-miR-577	CLIP-seq
MIRT2345476	hsa-miR-599	CLIP-seq
MIRT1411034	hsa-miR-661	CLIP-seq
MIRT1411035	hsa-miR-665	CLIP-seq
MIRT1411036	hsa-miR-759	CLIP-seq
MIRT1411037	hsa-miR-762	CLIP-seq
MIRT1411038	hsa-miR-765	CLIP-seq
MIRT1411039	hsa-miR-93	CLIP-seq
MIRT1410963	hsa-miR-106a	CLIP-seq
MIRT1410964	hsa-miR-106b	CLIP-seq
MIRT1410966	hsa-miR-142-5p	CLIP-seq
MIRT1410968	hsa-miR-17	CLIP-seq
MIRT1410969	hsa-miR-20a	CLIP-seq
MIRT1410970	hsa-miR-20b	CLIP-seq
MIRT1410972	hsa-miR-302a	CLIP-seq
MIRT1410973	hsa-miR-302b	CLIP-seq
MIRT1410974	hsa-miR-302c	CLIP-seq
MIRT1410975	hsa-miR-302d	CLIP-seq
MIRT1410976	hsa-miR-302e	CLIP-seq
MIRT1410981	hsa-miR-3202	CLIP-seq
MIRT1410983	hsa-miR-3609	CLIP-seq
MIRT1410985	hsa-miR-3677-3p	CLIP-seq
MIRT1410986	hsa-miR-372	CLIP-seq
MIRT1410987	hsa-miR-373	CLIP-seq
MIRT1410996	hsa-miR-4440	CLIP-seq
MIRT1411004	hsa-miR-4533	CLIP-seq
MIRT1411014	hsa-miR-4777-5p	CLIP-seq
MIRT1411016	hsa-miR-4785	CLIP-seq
MIRT1411017	hsa-miR-4796-3p	CLIP-seq
MIRT1411023	hsa-miR-519d	CLIP-seq
MIRT1411024	hsa-miR-520a-3p	CLIP-seq
MIRT1411025	hsa-miR-520b	CLIP-seq
MIRT1411026	hsa-miR-520c-3p	CLIP-seq
MIRT1411028	hsa-miR-520d-3p	CLIP-seq
MIRT1411029	hsa-miR-520e	CLIP-seq
MIRT1411031	hsa-miR-548ah	CLIP-seq
MIRT1411033	hsa-miR-577	CLIP-seq
MIRT1411039	hsa-miR-93	CLIP-seq
MIRT2461130	hsa-miR-146b-3p	CLIP-seq
MIRT2461131	hsa-miR-3155	CLIP-seq
MIRT2461132	hsa-miR-3155b	CLIP-seq
MIRT2461133	hsa-miR-3173-5p	CLIP-seq
MIRT2461134	hsa-miR-874	CLIP-seq

Show/Hide all (75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	NAS	10660600
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10660600, 11279118
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	22683681
GO:0004709	Function	MAP kinase kinase kinase activity	NAS	22683681
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006612	Process	Protein targeting to membrane	NAS	10660600
GO:0006915	Process	Apoptotic process	NAS	10660600
GO:0006974	Process	DNA damage response	IDA	17396146
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	17396146
GO:0007409	Process	Axonogenesis	IEA
GO:0007409	Process	Axonogenesis	IGI	22683681
GO:0007409	Process	Axonogenesis	ISS	22683681
GO:0008360	Process	Regulation of cell shape	IDA	10660600
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	ISS	22683681
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	NAS	10660600
GO:0016740	Function	Transferase activity	IEA
GO:0030036	Process	Actin cytoskeleton organization	IDA	10660600
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS	22683681
GO:0030425	Component	Dendrite	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IDA	10660600
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IPI	11279118
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IBA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IMP	17396146
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS	22683681
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	22683681
GO:0038191	Function	Neuropilin binding	IEA
GO:0038191	Function	Neuropilin binding	IPI	22683681
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS	22683681
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	10660600
GO:0043539	Function	Protein serine/threonine kinase activator activity	TAS	22683681
GO:0044294	Component	Dendritic growth cone	IEA
GO:0044294	Component	Dendritic growth cone	ISS	22683681
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS	22683681
GO:0046330	Process	Positive regulation of JNK cascade	IBA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	10660600
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0046330	Process	Positive regulation of JNK cascade	ISS	22683681
GO:0046330	Process	Positive regulation of JNK cascade	TAS	22683681
GO:0046330	Process	Positive regulation of JNK cascade	TAS	22683681
GO:0048041	Process	Focal adhesion assembly	IDA	10660600
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048667	Process	Cell morphogenesis involved in neuron differentiation	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0051403	Process	Stress-activated MAPK cascade	IDA	11279118
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0150019	Process	Basal dendrite morphogenesis	IEA
GO:0150019	Process	Basal dendrite morphogenesis	ISS	22683681
GO:0150020	Process	Basal dendrite arborization	IEA
GO:0150020	Process	Basal dendrite arborization	ISS	22683681

MIM	HGNC	e!Ensembl
613199	16835	ENSG00000149930

Q9UL54

Protein name

Serine/threonine-protein kinase TAO2 (EC 2.7.11.1) (Kinase from chicken homolog C) (hKFC-C) (Prostate-derived sterile 20-like kinase 1) (PSK-1) (PSK1) (Prostate-derived STE20-like kinase 1) (Thousand and one amino acid protein kinase 2)

Protein function

Serine/threonine-protein kinase involved in different processes such as membrane blebbing and apoptotic bodies formation DNA damage response and MAPK14/p38 MAPK stress-activated MAPK cascade. Phosphorylates itself, MBP, activated MAPK8, MAP2K3,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	28 → 281	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with a higher level of expression in testis and brain. {ECO:0000269|PubMed:10660600, ECO:0000269|PubMed:13679851}.

Sequence

MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMS
YSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA
VRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSIS
ASSQSSSVNSLADASDNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLP
GSDNLYDDPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRNRDHFATIRTASLVSRQIQ
EHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAE
KLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQE
NPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQD
LLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEY
NKRREQELRQKHAAQVRQQPKSLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQ
EAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVW
GLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPE
EEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVG
SSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLL
AQGTALGAVLGLSWRRGLMGVPLGLGAAWLLAWPGLALPLVAMAAGGRWVRQQGPRVRRG
ISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRSRLPVPGPRRRNPRTT
QHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTRIPRLLPR
SQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR

Sequence length

1235

Interactions

View interactions

	KEGG
	MAPK signaling pathway

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Autism	Uncertain significance	rs2543610796	RCV002286563
Melanoma	Likely benign	rs756043835	RCV005934726
See cases	Uncertain significance	rs752250092, rs916550664, rs1409976034	RCV002253112 RCV002253125 RCV003151933
TAOK2-associated neurodevelopmental disorder	Uncertain significance	rs765474532	RCV005256839
TAOK2-related disorder	Likely benign; Benign; Uncertain significance	rs78092725, rs61738514, rs3814883, rs4077410, rs11864149, rs371609102, rs763384286, rs61739161, rs368747234, rs554129882, rs760941502, rs143930866, rs557980258, rs200782919, rs200146768 View all (17 more)	RCV003920918 RCV003931086 RCV003980556 RCV003980632 RCV003980557 RCV003892963 RCV003911250 RCV003911169 RCV003911320 RCV003948895 RCV003968836 RCV003913559 RCV004753506 RCV003978525 RCV003958806 RCV003961080 RCV003403992 RCV003414431 RCV003894221 RCV003909589 RCV003911884 RCV003961763 RCV003961786 RCV003961811 RCV003951609 RCV003934771 RCV003961450 RCV003981795 RCV003969195 RCV003978249 RCV003972849 RCV003930522 RCV003930545

Show/Hide Text Mining Associations (17)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	10580105
Adenocarcinoma of Lung	Inhibit	32236130
Alzheimer Disease	Associate	33794991
Autistic Disorder	Associate	39737487
Developmental Disabilities	Associate	39737487
Fetal Alcohol Spectrum Disorders	Associate	39737487
GATA2 Deficiency	Associate	32321919
Leukemia Myeloid Acute	Associate	20159944
Megalencephaly	Associate	39737487
Neoplasms	Inhibit	32236130, 7728773
Neoplasms	Associate	40095483
Obesity	Associate	39737487
Prostatic Neoplasms	Associate	10660600
Prostatitis	Associate	10660600
Psychotic Disorders	Associate	23164818
Schizophrenia	Associate	23164818
ST Elevation Myocardial Infarction	Associate	26367242

TAOK2 (TAO kinase 2)