Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9340
Gene name Gene Name - the full gene name approved by the HGNC.
Glucagon like peptide 2 receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GLP2R
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17p13.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a G protein-coupled receptor that is closely related to the glucagon receptor and binds to glucagon-like peptide-2 (GLP2). Signalling through GLP2 stimulates intestinal growth and increases villus height in the small intestine, concomita
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT696128 hsa-miR-548c-3p HITS-CLIP 23313552
MIRT696127 hsa-miR-6771-3p HITS-CLIP 23313552
MIRT696126 hsa-miR-3613-3p HITS-CLIP 23313552
MIRT696125 hsa-miR-6849-3p HITS-CLIP 23313552
MIRT696124 hsa-miR-340-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 9990065
GO:0004967 Function Glucagon receptor activity IBA
GO:0004967 Function Glucagon receptor activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603659 4325 ENSG00000065325
Protein
UniProt ID O95838
Protein name Glucagon-like peptide 2 receptor (GLP-2 receptor) (GLP-2-R) (GLP-2R)
Protein function This is a receptor for glucagon-like peptide 2. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
PDB 7D68
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02793 HRM 93 162 Hormone receptor domain Family
PF00002 7tm_2 175 432 7 transmembrane receptor (Secretin family) Family
Sequence
MKLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRPFLTLVLLVS
IKQVTGSLLEETTRKWAQYKQACLRDLLKEPSGIFCNGTFDQYVCWPHSSPGNVSVPCPS
YLPWWSEESSGRAYRHCLAQGTWQTIENATDIWQDDSECSEN
HSFKQNVDRYALLSTLQL
MYTVGYSFSLISLFLALTLLLFLRKLHCTRNYIHMNLFASFILRTLAVLVKDVVFYNSYS
KRPDNENGWMSYLSEMSTSCRSVQVLLHYFVGANYLWLLVEGLYLHTLLEPTVLPERRLW
PRYLLLGWAFPVLFVVPWGFARAHLENTGCWTTNGNKKIWWIIRGPMMLCVTVNFFIFLK
ILKLLISKLKAHQMCFRDYKYRLAKSTLVLIPLLGVHEILFSFITDDQVEGFAKLIRLFI
QLTLSSFHGFLV
ALQYGFANGEVKAELRKYWVRFLLARHSGCRACVLGKDFRFLGKCPKK
LSEGDGAEKLRKLQPSLNSGRLLHLAMRGLGELGAQPQQDHARWPRGSSLSECSEGDVTM
ANTMEEILEESEI
Sequence length 553
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   G alpha (s) signalling events
Glucagon-type ligand receptors
ADORA2B mediated anti-inflammatory cytokines production
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Apraxias Associate 27120335
Colorectal Neoplasms Associate 21948569, 37076536
Coronary Artery Disease Associate 33544567
Diabetes Gestational Associate 36313769
Diabetes Mellitus Associate 32936762
Diabetes Mellitus Type 2 Associate 28566273, 33414548
Inflammation Inhibit 34290670
Lung Neoplasms Associate 35027025
Metabolic Diseases Associate 32936762
Neoplasms Inhibit 37076536