Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9334
Gene name Gene Name - the full gene name approved by the HGNC.
Beta-1,4-galactosyltransferase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
B4GALT5
Synonyms (NCBI Gene) Gene synonyms aliases
B4Gal-T5, BETA4-GALT-IV, beta4Gal-T5, beta4GalT-V, gt-V
Chromosome Chromosome number
20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
20q13.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to si
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT018798 hsa-miR-335-5p Microarray 18185580
MIRT023032 hsa-miR-124-3p Microarray 18668037
MIRT048365 hsa-miR-29b-3p CLASH 23622248
MIRT041131 hsa-miR-503-5p CLASH 23622248
MIRT437640 hsa-miR-152-3p Microarray, qRT-PCR 22815788
Transcription factors
Transcription factor Regulation Reference
SP1 Activation 15263012;16873896
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane TAS
GO:0003945 Function N-acetyllactosamine synthase activity IEA
GO:0005794 Component Golgi apparatus IBA 21873635
GO:0006486 Process Protein glycosylation ISS
GO:0008378 Function Galactosyltransferase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604016 928 ENSG00000158470
Protein
UniProt ID O43286
Protein name Beta-1,4-galactosyltransferase 5 (Beta-1,4-GalTase 5) (Beta4Gal-T5) (b4Gal-T5) (EC 2.4.1.-) (Beta-1,4-GalT II) (Glucosylceramide beta-1,4-galactosyltransferase) (EC 2.4.1.274) (Lactosylceramide synthase) (LacCer synthase) (UDP-Gal:beta-GlcNAc beta-1,4-gal
Protein function Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:24498430). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13733 Glyco_transf_7N 114 249 N-terminal region of glycosyl transferase group 7 Domain
PF02709 Glyco_transf_7C 253 331 N-terminal domain of galactosyltransferase Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:9435216}.
Sequence
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTI
GAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPS
MKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVL
FRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPE
SDRNYYGCG
QMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGED
DDLWNRVQNAGYSVSRPEGDTGKYKSIPHHH
RGEVQFLGRYALLRKSKERQGLDGLNNLN
YFANITYDALYKNITVNLTPELAQVNEY
Sequence length 388
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Mucin type O-glycan biosynthesis
Sphingolipid metabolism
Metabolic pathways
  Keratan sulfate biosynthesis
O-linked glycosylation of mucins
N-Glycan antennae elongation
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthritis Juvenile arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470 19565504
Associations from Text Mining
Disease Name Relationship Type References
Astrocytoma Associate 11501750
Breast Neoplasms Associate 9435216
Carcinoma Hepatocellular Associate 35410157, 40159482
Cardiomegaly Associate 37658291
Glioma Associate 16461357, 17938207, 29269413
Hypertrophy Associate 37658291
Neoplasms Associate 15263012, 39210397
Ovarian Neoplasms Associate 36611197, 39210397
Testicular Diseases Associate 33741265
Uterine Cervical Neoplasms Associate 31847655