Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
9326
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger HIT-type containing 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNHIT3
Synonyms (NCBI Gene) Gene synonyms aliases
Hit1, PEHO, TRIP3
Disease Acronyms (UniProt) Disease acronyms from UniProt database
PEHO
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024305 hsa-miR-215-5p Microarray 19074876
MIRT026564 hsa-miR-192-5p Microarray 19074876
MIRT043888 hsa-miR-378a-3p CLASH 23622248
MIRT449216 hsa-miR-100-3p PAR-CLIP 22100165
MIRT449214 hsa-miR-4795-5p PAR-CLIP 22100165
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000463 Process Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA 21873635
GO:0000492 Process Box C/D snoRNP assembly IBA 21873635
GO:0005515 Function Protein binding IPI 25170085, 28335020, 28514442, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 28335020
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604500 12309 ENSG00000273611
Protein
UniProt ID Q15649
Protein name Zinc finger HIT domain-containing protein 3 (HNF-4a coactivator) (Thyroid hormone receptor interactor 3) (Thyroid receptor-interacting protein 3) (TR-interacting protein 3) (TRIP-3)
PDB 2YQQ , 5L85
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04438 zf-HIT 7 36 HIT zinc finger Domain
Sequence
MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTK
TVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQG
EDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
Sequence length 155
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Arthrogryposis multiplex congenita Arthrogryposis rs1586285494, rs80358233, rs137853305, rs1559154278, rs398124167, rs398124172, rs587780399, rs786204576, rs786204430, rs769345284, rs749355583, rs793888524, rs793888525, rs878854368, rs555445835
View all (138 more)
Developmental delay Global developmental delay rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291
View all (32 more)
Hydrocephalus Hydrocephalus rs387907320, rs369384363, rs387907321, rs372127610, rs770273135, rs797045095, rs797045707, rs769795916, rs781251438, rs922703465, rs376078512, rs1567043467, rs1587149916, rs1586841546
Mental retardation Severe intellectual disability rs5742905, rs267607136, rs267607137, rs2131714307, rs267607038, rs267607042, rs80338685, rs137853127, rs80338815, rs28940893, rs387906309, rs121908096, rs121908099, rs587784365, rs121918315
View all (1024 more)
Unknown
Disease term Disease name Evidence References Source
Porencephalic cyst Porencephalic cyst ClinVar
PEHO Syndrome PEHO syndrome GenCC
Multiple Sclerosis Multiple Sclerosis GWAS
Diabetes Diabetes GWAS
Associations from Text Mining
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 28639078
Developmental Disabilities Associate 35843310
Diabetes Mellitus Type 2 Associate 17656577
Mason Type Diabetes Associate 17656577
PEHO syndrome Associate 31048081, 35843310