Gene Gene information from NCBI Gene database.
Entrez ID 9326
Gene name Zinc finger HIT-type containing 3
Gene symbol ZNHIT3
Synonyms (NCBI Gene)
Hit1PEHOTRIP3
Chromosome 17
Chromosome location 17q12
miRNA miRNA information provided by mirtarbase database.
160
miRTarBase ID miRNA Experiments Reference
MIRT024305 hsa-miR-215-5p Microarray 19074876
MIRT026564 hsa-miR-192-5p Microarray 19074876
MIRT043888 hsa-miR-378a-3p CLASH 23622248
MIRT449216 hsa-miR-100-3p PAR-CLIP 22100165
MIRT449214 hsa-miR-4795-5p PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0000463 Process Maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) IBA
GO:0000492 Process Box C/D snoRNP assembly IBA
GO:0005515 Function Protein binding IPI 25170085, 28335020, 28514442, 32296183, 33961781
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 28335020
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604500 12309 ENSG00000273611
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15649
Protein name Zinc finger HIT domain-containing protein 3 (HNF-4a coactivator) (Thyroid hormone receptor interactor 3) (Thyroid receptor-interacting protein 3) (TR-interacting protein 3) (TRIP-3)
PDB 2YQQ , 5L85
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04438 zf-HIT 7 36 HIT zinc finger Domain
Sequence
MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTK
TVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQG
EDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
Sequence length 155
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
9
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
PEHO syndrome Likely pathogenic rs148890852 RCV000490627
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Lung cancer Likely benign rs377271926 RCV005902915
ZNHIT3-related disorder Likely benign; Benign rs746721426, rs140610432, rs112194209 RCV003921509
RCV003979144
RCV003916215
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Associate 28639078
Developmental Disabilities Associate 35843310
Diabetes Mellitus Type 2 Associate 17656577
Mason Type Diabetes Associate 17656577
PEHO syndrome Associate 31048081, 35843310