Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	932
Gene name	Membrane spanning 4-domains A3
Gene symbol	MS4A3
Synonyms (NCBI Gene)	CD20LHTM4
Chromosome	11
Chromosome location	11q12.1
Summary	This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells a

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021210	hsa-miR-150-5p	Microarray	20218812
MIRT1161025	hsa-miR-509-3p	CLIP-seq
MIRT1161026	hsa-miR-578	CLIP-seq
MIRT1161027	hsa-miR-581	CLIP-seq
MIRT2438794	hsa-miR-125a-5p	CLIP-seq
MIRT2438795	hsa-miR-125b	CLIP-seq
MIRT2438796	hsa-miR-3163	CLIP-seq
MIRT2438797	hsa-miR-4319	CLIP-seq
MIRT2438798	hsa-miR-4668-3p	CLIP-seq
MIRT2438799	hsa-miR-4732-3p	CLIP-seq
MIRT2438800	hsa-miR-605	CLIP-seq
MIRT2438801	hsa-miR-670	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15671017, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA

MIM	HGNC	e!Ensembl
606498	7317	ENSG00000149516

Q96HJ5

Protein name

Membrane-spanning 4-domains subfamily A member 3 (CD20 antigen-like protein) (Hematopoietic-specific transmembrane protein 4) (HTm4)

Protein function

Hematopoietic modulator for the G1-S cell cycle transition. Modulates the level of phosphorylation of cyclin-dependent kinase 2 (CDK2) through its direct binding to cyclin-dependent kinase inhibitor 3 (CDKN3/KAP).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04103	CD20	50 → 196	CD20-like family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in hematopoietic cells and tissues.

Sequence

MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAA
MILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQN
SFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLIL
TLLELCVTISTIAMWCNANCCNSREEISSPPNSV

Sequence length

214

Interactions

View interactions

	Reactome
			Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
COVID 19	Associate	34346525	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	30185669	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Hypersensitivity	Associate	25973893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunoglobulin G4 Related Disease	Associate	25973893	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	27579896	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pregnancy Complications	Stimulate	33045922	★★★★★ ★☆☆☆☆ Found in Text Mining only
ST Elevation Myocardial Infarction	Associate	38597542	★★★★★ ★☆☆☆☆ Found in Text Mining only

MS4A3 (membrane spanning 4-domains A3)