Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
93166
Gene name Gene Name - the full gene name approved by the HGNC.
PR/SET domain 6
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PRDM6
Synonyms (NCBI Gene) Gene synonyms aliases
KMT8C, PDA3, PRISM
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q23.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcriptional repressor and a member of the PRDM family. Family members contain a PR domain and multiple zinc-finger domains. The encoded protein is involved in regulation of vascular smooth muscle cells (VSMC) cont
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs879253872 A>G Pathogenic Coding sequence variant, non coding transcript variant, missense variant
rs879255278 G>A Pathogenic Non coding transcript variant, genic downstream transcript variant, missense variant, downstream transcript variant, coding sequence variant
rs879255279 G>C Pathogenic Coding sequence variant, non coding transcript variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT311378 hsa-miR-3617-5p PAR-CLIP 20371350
MIRT311377 hsa-miR-641 PAR-CLIP 20371350
MIRT311381 hsa-miR-4802-3p PAR-CLIP 20371350
MIRT311379 hsa-miR-3688-3p PAR-CLIP 20371350
MIRT311382 hsa-miR-5093 PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 16537907
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0006325 Process Chromatin organization IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616982 9350 ENSG00000061455
Protein
UniProt ID Q9NQX0
Protein name Putative histone-lysine N-methyltransferase PRDM6 (EC 2.1.1.361) (PR domain zinc finger protein 6) (PR domain-containing protein 6)
Protein function Putative histone methyltransferase that acts as a transcriptional repressor of smooth muscle gene expression. Promotes the transition from differentiated to proliferative smooth muscle by suppressing differentiation and maintaining the prolifera
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00856 SET 259 365 SET domain Family
PF00096 zf-C2H2 501 523 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 529 551 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 557 578 Zinc finger, C2H2 type Domain
Sequence
MLKPGDPGGSAFLKVDPAYLQHWQQLFPHGGAGPLKGSGAAGLLSAPQPLQPPPPPPPPE
RAEPPPDSLRPRPASLSSASSTPASSSTSASSASSCAAAAAAAALAGLSALPVSQLPVFA
PLAAAAVAAEPLPPKELCLGATSGPGPVKCGGGGGGGGEGRGAPRFRCSAEELDYYLYGQ
QRMEIIPLNQHTSDPNNRCDMCADNRNGECPMHGPLHSLRRLVGTSSAAAAAPPPELPEW
LRDLPREVCLCTSTVPGLAYGICAAQRIQQGTWIGPFQGVLLPPEKVQAGAVRNTQHLWE
IYDQDGTLQHFIDGGEPSKSSWMRYIRCARHCGEQNLTVVQYRSNIFYRACIDIPRGTEL
LVWYN
DSYTSFFGIPLQCIAQDENLNVPSTVMEAMCRQDALQPFNKSSKLAPTTQQRSVV
FPQTPCSRNFSLLDKSGPIESGFNQINVKNQRVLASPTSTSQLHSEFSDWHLWKCGQCFK
TFTQRILLQMHVCTQNPDRPYQCGHCSQSFSQPSELRNHVVTHSSDRPFKCGYCGRAFAG
ATTLNNHIRTH
TGEKPFKCERCERSFTQATQLSRHQRMPNECKPITESPESIEVD
Sequence length 595
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  
  Lysine degradation
Metabolic pathways
 
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Patent ductus arteriosus patent ductus arteriosus 3 rs879255278, rs879255279, rs879253872 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Breast cancer N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Type ii diabetes, Type 2 diabetes N/A N/A GWAS
Hypertension Hypertension (confirmatory factor analysis Factor 12), Hypertension (PheCode 401), Essential hypertension (PheCode 401.1), High blood pressure / hypertension N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 25342443, 36344993
Ductus Arteriosus Patent Associate 27181681
Hypomagnesemia primary Associate 40335697
Medulloblastoma Associate 28726821, 36131014, 40335697
Nonsyndromic Deafness Associate 27181681
Obesity Associate 29145611
Osteoporosis Associate 29145611
Thinness Associate 30677029